Azoarcus sp. DN11: CDA09_15280 Help Entry CDA09_15280       CDS       T05691                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azd  Azoarcus sp. DN11 Pathway azd01100   Metabolic pathways azd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDA09_15280    00074 Mycolic acid biosynthesis     CDA09_15280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDA09_15280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AYH44729 LinkDB All DBs Position complement(3323819..3324058) Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKIESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgagcagcgcgtcaagaaaattgtcgccgaacaacttggtgtgaacgag tcggaaatcaagatcgagtcctcgttcgtcgacgatctgggcgcggattcgctggatacc gtggaactggtcatggcactcgaggaagagttcgagtgcgaaatcccggacgaagaagct gagaagatcaccacggttcagcaggcgattgactacgtcaacgcccacctgaagaagtaa

DBGET integrated database retrieval system