Arthrobacter zhangbolii: MUK71_10270 Help Entry MUK71_10270       CDS       T08979                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azh  Arthrobacter zhangbolii Pathway azh00998   Biosynthesis of various antibiotics azh01100   Metabolic pathways azh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MUK71_10270    00074 Mycolic acid biosynthesis     MUK71_10270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MUK71_10270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Ag332 Motif Other DBs NCBI-ProteinID:  UON91009 UniProt:  A0A9X1S8C4 LinkDB All DBs Position 2203829..2204074 Genome browser AA seq 81 aa AA seqDB search MASNEEILAGLAEIVNEETGLAPEAVELDKSFTDDLDIDSISMMTIVVNAEEKFGVRIPD EEVKNLKTVGDAVDFISNAQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctagcaacgaagaaatcctggccggcctcgccgagatcgtcaacgaagagaccggc ctggcccccgaggccgtcgagctggataagtccttcaccgatgacctggacatcgactcc atttccatgatgaccatcgtggtcaacgctgaagagaagttcggcgtgcgcatccctgac gaagaggtcaagaacctgaagaccgtcggcgacgccgtggacttcatctccaacgcccag gcctaa

DBGET integrated database retrieval system