Azoarcus sp. CIB: AzCIB_2800 Help Entry AzCIB_2800        CDS       T04019                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azi  Azoarcus sp. CIB Pathway azi01100   Metabolic pathways azi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AzCIB_2800    00074 Mycolic acid biosynthesis     AzCIB_2800   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AzCIB_2800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF1493 DUF5783 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AKU12693 LinkDB All DBs Position complement(3137985..3138224) Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKIESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgagcagcgcgtcaagaaaattgtcgccgaacaacttggtgtgaacgag tcggaaatcaagatcgagtcctcgttcgtcgacgatctgggcgcggattcgctggatacc gtggaactggtcatggccctcgaggaagagttcgagtgcgaaatcccggacgaggaagct gagaagatcaccacggttcagcaggcgattgactacgtcaacgcccacctgaagaagtaa

DBGET integrated database retrieval system