Azospirillum sp. B510: AZL_a05920 Help Entry AZL_a05920        CDS       T01169                                  Name (GenBank) mbtH domain protein   KO K05375   MbtH protein Organism azl  Azospirillum sp. B510 Pathway azl00261   Monobactam biosynthesis azl01100   Metabolic pathways azl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AZL_a05920  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:azl01008]     AZL_a05920 Polyketide biosynthesis proteins [BR:azl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AZL_a05920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAI74123 LinkDB All DBs Position pAB510a:740879..741100 Genome browser AA seq 73 aa AA seqDB search MTTETTIEAAAGTGELYDVVVNDEQQYSIWPAGRDVPAGWRKAVPAPAPKAECLERIERV WTDMRPASLRRRD NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgacgactgaaacgacgattgaagcggcggccggaaccggggaactctacgacgtcgtc gtcaacgacgagcaacaatattcgatctggccggccggccgggacgtgcccgccggatgg cgcaaggcggttccggccccggcccccaaggccgaatgcctggagcggatcgaacgggtc tggaccgacatgcgtccggcaagcctgcgccgccgggattga

DBGET integrated database retrieval system