Azoarcus olearius BH72: azo0262 Help Entry azo0262           CDS       T00441                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism azo  Azoarcus olearius BH72 Pathway azo00998   Biosynthesis of various antibiotics azo01100   Metabolic pathways azo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     azo0262    00074 Mycolic acid biosynthesis     azo0262   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     azo0262 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAL92879 UniProt:  A1K224 LinkDB All DBs Position complement(289885..290169) Genome browser AA seq 94 aa AA seqDB search MTHTAPASADAALLAEVAALIVTALNLEVRAEDIEPDAPLYGEGLGLDSIDILEVALVVS KRYGFSLRADNEDNLKIFASLRSLGDYIATHRVQ NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgacccacaccgcccccgcatccgccgatgccgccctgctcgccgaagtcgccgcgctg atcgtcaccgcgctcaatctcgaagtccgcgcggaggacatcgaaccggatgcgccgctc tacggcgaaggcctgggactggactccatcgacatcctcgaggtggcgctggtggtgtcc aagcgctacggcttctcgctgcgcgccgacaacgaggacaacctgaagatcttcgcctcg ctgcgcagcctgggcgactacatcgccacccaccgggtgcagtga

DBGET integrated database retrieval system