Azoarcus olearius BH72: azo0973 Help Entry azo0973           CDS       T00441                                  Symbol groES1 Name (GenBank) chaperonin GroES   KO K04078   chaperonin GroES Organism azo  Azoarcus olearius BH72 Brite KEGG Orthology (KO) [BR:azo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:azo03110]     azo0973 (groES1)    03029 Mitochondrial biogenesis [BR:azo03029]     azo0973 (groES1) Chaperones and folding catalysts [BR:azo03110]  Heat shock proteins   HSP10    azo0973 (groES1) Mitochondrial biogenesis [BR:azo03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     azo0973 (groES1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  CAL93590 UniProt:  A1K435 LinkDB All DBs Position 1045436..1045726 Genome browser AA seq 96 aa AA seqDB search MKIRPLHDRVIVKRLEAERKTASGIVIPDSAGEKPDQGEVLAVGNGKILDDGKVRPMAVQ VGDKVLFGKYAGQSVKVEGEELLVMREEDIMGVVEA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaagattcgtcccttgcatgatcgcgtgatcgtcaagcgtctggaagccgaacgcaag accgccagcggcatcgtgatccccgactccgcgggcgaaaagcccgaccagggcgaagtc ctggcggtcggtaacggcaagatcctggacgacggcaaggtccgcccgatggccgttcag gtcggcgacaaggtgctgttcggcaagtacgccggccagtccgtgaaggtcgagggcgaa gagctgctcgtcatgcgcgaagaagacatcatgggtgtggtcgaggcctga

DBGET integrated database retrieval system