Azoarcus olearius BH72: azo2812 Help Entry azo2812           CDS       T00441                                  Symbol secB Name (GenBank) protein export chaperone SecB   KO K03071   preprotein translocase subunit SecB Organism azo  Azoarcus olearius BH72 Pathway azo02024   Quorum sensing azo03060   Protein export azo03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:azo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     azo2812 (secB)  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     azo2812 (secB)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     azo2812 (secB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:azo03110]     azo2812 (secB)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:azo02044]     azo2812 (secB) Chaperones and folding catalysts [BR:azo03110]  Other chaperones and cochaperones   SecB    azo2812 (secB) Secretion system [BR:azo02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    azo2812 (secB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecB Motif Other DBs NCBI-ProteinID:  CAL95428 UniProt:  A1K9C3 LinkDB All DBs Position 3093432..3093887 Genome browser AA seq 151 aa AA seqDB search MTENAQPMFSIEKIYIKDLSLEVPNAPKIFLERDTPQISVQLRTEGNTVDEGLYEVTLTV TVSATLGEDRSVFLVEVAQAGVFQIRNVPPAELEPVMMIGCPNILFPYAREAVSAAVSRA GFQPIVLAPVNFEALYQQQQAAKEGGDVAIQ NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgaccgaaaacgcccagccgatgttctccatcgaaaagatctacatcaaggatctttcg ctcgaagtccccaacgcaccgaagatcttcctggagcgcgacacgccgcagatcagcgtg caactgcgcaccgagggcaacacggtggacgaaggcctgtacgaagtgacgctgaccgtc accgtgtcggccacgcttggcgaagaccgctcggtgttcctggtcgaggttgcccaggcg ggcgtgttccagatccgcaacgtgccgcccgccgaactcgagccggtgatgatgatcggc tgccccaacatcctgttcccgtacgcccgcgaagccgtttccgcggcggtcagccgtgcc ggcttccagccgatcgtgctcgcgccggtaaacttcgaagcgctctaccagcaacaacaa gctgccaaggaaggcggcgacgtcgccatccagtaa

DBGET integrated database retrieval system