KEGG   Azoarcus olearius BH72: azo2972
Entry
azo2972           CDS       T00441                                 

Symbol
exaA2
Name
(GenBank) ExaA2 protein
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
azo  Azoarcus olearius BH72
Brite
KEGG Orthology (KO) [BR:azo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    azo2972 (exaA2)
Enzymes [BR:azo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     azo2972 (exaA2)
SSDB
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Other DBs
NCBI-ProteinID: CAL95588
RhizoBase: azo2972
UniProt: A1K9T3
LinkDB
Position
3261821..3263698
AA seq 625 aa
MRTKQPAPRLRMTVAALAAALALPVAAASNVTWDDIANDDKTTGDVLSYGLGLKAQRHST
LKQVNTKNVAGLVPAWTFSFGGEKQRGQEGQVLVHDGVIYATASYSRFFAIDARSGKRLW
EYEHRLPDDIRPCCDVVNRGPAIYGDKVFFGTLDASIVALDKNTGKVAWKKKFADHKVGY
TMTGAPFIVKDQKSGKILLVHGSSGDEFGVVGWLYARDPDTGEEVWARPLVEGHVGRLNG
KDSTPTGDAKAPSWPNDPNSPTGKVEAWSHGGGAPWQTASFDAENNTIVIGAGNPAPWNT
WKRTAQGDDPQNWDNLFTSGQAYVDASTGELKGFYQHTPNDAWDFSGNNSIILFEYKDPK
TGKQVKASAHADRNGFFFVTDRDKLANGAGYPNKPTSLIGAWPFVDGITWASGFDLKTGK
PIEKGNRPPAPKEGADKGDSVFVSPPFLGGTNWHPMSYSPDTGLFYIPANHWAMDYWTEH
LTYKAGSAYLGQGFRIKRLFDDHVGVLRAIDPKSGKIAWEHKEKFPLWAGTLTTAGGLIF
TGTSDGYVKAFDAKNGKELWSFQTGSGVVSVPVTWEMDGEQYIGIQSGYGGAVPLWGGDM
ADLTKQVTQGGSMWVFKLPRQVASK
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgagaaccaagcaacccgcgccccggctgcgcatgaccgtcgccgcgctcgccgccgcg
cttgcgctgcccgtcgcagccgccagcaacgtcacgtgggacgacatcgccaacgacgac
aagaccaccggcgacgtgctgtcctacggcctcggcctcaaggcgcagcgccacagcacc
ttgaagcaggtgaacacgaagaacgtcgccggcctggtgccggcgtggaccttctccttc
ggcggcgagaagcagcgcggccaggaaggccaggtgctggtgcatgacggggtgatctac
gccaccgcgtcgtactcgcgcttcttcgccatcgacgcccgcagcggcaagcgcctgtgg
gaatacgagcatcgcctgcccgacgacatccgcccctgctgcgacgtggtcaaccgcggc
ccggcgatctacggcgacaaggtgttcttcggcacgctggacgcctccatcgtcgcgctc
gacaagaacaccggcaaggtggcgtggaagaagaagttcgccgaccacaaggtcggctac
accatgaccggcgctcccttcatcgtgaaggaccagaagagcggcaagatcctgctggtg
cacggctcctccggcgacgagttcggcgtggtcggctggctgtatgcgcgcgacccggac
accggcgaggaagtgtgggcgcggccgctggtcgaaggccacgtgggccgactcaacggc
aaggacagcacgcccaccggcgacgccaaggcgccgtcgtggccgaacgacccgaactcc
cccaccggcaaggtcgaggcctggagccacggcggcggcgcgccctggcagaccgccagc
ttcgatgccgagaacaacaccatcgtcatcggcgccggcaaccccgcgccgtggaacacc
tggaagcgcaccgcgcagggcgacgatccgcagaactgggacaacctgttcacctccggc
caggcttacgtggatgctagcaccggcgagctgaagggcttctaccagcacaccccgaac
gacgcctgggacttctccggcaacaactccatcatcctgttcgaatacaaggacccgaag
accggcaagcaggtaaaggcctcggcgcatgccgaccgcaacggcttcttcttcgtcacc
gaccgcgacaagctcgccaacggcgccggctaccccaacaagccgacctcgctgatcggc
gcctggcccttcgtcgatggcatcacctgggcgtcgggcttcgacctcaagaccggcaag
ccgatcgagaagggcaaccggccgcccgcgcccaaggaaggcgccgacaagggcgactcg
gtgttcgtctcgccgcccttcctcggcggcaccaactggcatccgatgtcgtacagcccg
gacaccggcctgttctacatcccggccaaccactgggcgatggactactggaccgagcac
ctgacctacaaggccggctccgcctatctcggtcagggcttccgcatcaagcgcctgttc
gacgaccacgtcggcgtgctgcgcgcgatcgaccccaagagcggcaagatcgcctgggag
cacaaggagaaattcccgctgtgggccggcacgctgaccaccgccggcgggctgatcttc
accggcacctcggacggctacgtgaaggccttcgacgcgaagaacggcaaggagctgtgg
tccttccagaccggttccggcgtggtctcggtgccggtgacctgggagatggacggcgag
cagtacatcggcatccagtccggctacggtggcgcggtgccgctgtggggcggcgacatg
gccgacctcaccaagcaggtcacccagggcggttcgatgtgggtgttcaagctgccccgg
caggtggccagcaagtaa

DBGET integrated database retrieval system