Azospirillum sp. TSA2s: E6C67_22960 Help Entry E6C67_22960       CDS       T10588                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism azp  Azospirillum sp. TSA2s Brite KEGG Orthology (KO) [BR:azp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:azp03032]     E6C67_22960    03036 Chromosome and associated proteins [BR:azp03036]     E6C67_22960    03400 DNA repair and recombination proteins [BR:azp03400]     E6C67_22960 DNA replication proteins [BR:azp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E6C67_22960 Chromosome and associated proteins [BR:azp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E6C67_22960 DNA repair and recombination proteins [BR:azp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E6C67_22960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 DUF2267 Rpf1_C Motif Other DBs NCBI-ProteinID:  QCG96704 UniProt:  A0A4P7Z5P5 LinkDB All DBs Position 1:complement(213961..214233) Genome browser AA seq 90 aa AA seqDB search MNKNDLVAHVAEASGLSKTDATKAVDAVFDSIAESLKNGDEVRLVGFGTFAVAERPATEG RNPRTGEKIDIPASKQPKFKAGKTLKDALN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagaacgatctcgtggcgcatgttgccgaagcgtccggtctgtccaagaccgac gccacgaaggccgtcgacgccgtgttcgacagcatcgccgagtccttgaagaacggcgat gaagtccgtcttgtcggcttcggcaccttcgcggtggctgagcgccccgcgaccgagggc cgcaacccgcgtaccggcgagaagatcgacatcccggcatccaagcagccgaagttcaag gcgggcaagaccctcaaggacgctctgaactga

DBGET integrated database retrieval system