Nitrogeniibacter mangrovi: G3580_08225 Help Entry G3580_08225       CDS       T06549                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism azq  Nitrogeniibacter mangrovi Pathway azq00361   Chlorocyclohexane and chlorobenzene degradation azq00362   Benzoate degradation azq00623   Toluene degradation azq01100   Metabolic pathways azq01120   Microbial metabolism in diverse environments azq01220   Degradation of aromatic compounds Module azq_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:azq00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     G3580_08225    00361 Chlorocyclohexane and chlorobenzene degradation     G3580_08225    00623 Toluene degradation     G3580_08225 Enzymes [BR:azq01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      G3580_08225     1.14.13.244  phenol 2-monooxygenase (NADH)      G3580_08225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  QID17632 UniProt:  A0A6C1B1X6 LinkDB All DBs Position 1790642..1791001 Genome browser AA seq 119 aa AA seqDB search MAVAAVKEYTFESADRLENFHGNQLLFVGWEDHLLFCAPFALAMPPTTLFGDLVGKMLPG AFGYHPDFAKIDWNTVEWFKSGEPWQPQMDASLADNGLGHKAVIRFRTPGLTGIKGSCS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccgttgctgccgtcaaggaatacacgttcgagtccgccgaccggctcgagaacttt catggcaaccagctgctgttcgtgggctgggaagaccacctcttgttctgcgccccgttt gcgctggcgatgccgccgaccaccctgttcggcgatctggtcgggaagatgctgcccggt gcgttcggctatcaccccgacttcgcgaagatcgactggaacaccgtcgagtggttcaag tcgggcgagccctggcagccgcagatggacgcgtcgctggccgacaacggcctcgggcac aaggcggtcatccgcttccgcaccccgggcctgaccggcatcaaggggtcctgcagctga

DBGET integrated database retrieval system