Azoarcus sp. DD4: CJ010_01790 Help Entry CJ010_01790       CDS       T06048                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azr  Azoarcus sp. DD4 Pathway azr01100   Metabolic pathways azr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJ010_01790    00074 Mycolic acid biosynthesis     CJ010_01790   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJ010_01790 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDF95372 UniProt:  A0A4Y6KMZ9 LinkDB All DBs Position complement(369407..369679) Genome browser AA seq 90 aa AA seqDB search MSALHHELKVLIVDACDKTCSPDSITDDEILFGPDAPLALDSLDALQVSMALQKKYGVRL SDSKETRRILASVANLAAWLQAQGKAGAAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgctttgcaccacgaactcaaggtcctgatcgtcgacgcctgcgacaagacctgc agccccgattcgatcaccgacgacgaaatcctgttcggccccgatgcgccgctggcgctc gactcgctcgacgcgctgcaggtgtcgatggcgctgcagaagaagtacggcgtgcgcctg tcggacagcaaggaaacccgccgcatcctcgccagcgtggccaacctcgccgcctggctg caagcgcagggcaaggccggcgccgccgcgtga

DBGET integrated database retrieval system