Azoarcus sp. DD4: CJ010_04050 Help Entry CJ010_04050       CDS       T06048                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism azr  Azoarcus sp. DD4 Brite KEGG Orthology (KO) [BR:azr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:azr03036]     CJ010_04050 Chromosome and associated proteins [BR:azr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CJ010_04050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB ADIP PPP1R21_C DivIC bZIP_1 NET2A YabA TMF_TATA_bd Med21 bZIP_2 HALZ YvrJ Motif Other DBs NCBI-ProteinID:  QDF99618 UniProt:  A0A4Y6KZE2 LinkDB All DBs Position 840006..840200 Genome browser AA seq 64 aa AA seqDB search MTPELTRLEAQLEQLISLYAGLKAENRDLRARVVKLEADNHVLADKVKLAADKLETLLDQ LPEA NT seq 195 nt NT seq  +upstreamnt  +downstreamnt ctgactcccgaactgacccggctcgaagcgcagctcgagcagctgatcagcctctacgcc gggctcaaggccgagaatcgcgacctgcgtgcgcgggtggtgaagctcgaagccgacaat cacgtcctggcggacaaggtcaagcttgccgccgacaagctcgaaaccttgctcgaccag ttgccggaagcctga

DBGET integrated database retrieval system