Azoarcus sp. DD4: CJ010_09995 Help Entry CJ010_09995       CDS       T06048                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azr  Azoarcus sp. DD4 Pathway azr01100   Metabolic pathways azr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CJ010_09995    00074 Mycolic acid biosynthesis     CJ010_09995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CJ010_09995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 DUF5783 DUF1493 Motif Other DBs NCBI-ProteinID:  QDF96837 UniProt:  A0A4Y6KRC6 LinkDB All DBs Position 2147516..2147755 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKNESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaagaagatcgtcgctgagcaacttggcgtgaacgaa tcggagatcaagaacgagtcttcgttcgtggacgatctgggcgcggattcgctggacacc gtggaactggtcatggcgctggaagaagaattcgagtgcgaaattccggacgaagaagcc gagaagatcactaccgtccagcaagcgattgactacgtcaacgcccatctgaagaagtaa

DBGET integrated database retrieval system