Azoarcus sp. DD4: CJ010_12210 Help Entry CJ010_12210       CDS       T06048                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism azr  Azoarcus sp. DD4 Pathway azr00361   Chlorocyclohexane and chlorobenzene degradation azr00362   Benzoate degradation azr00623   Toluene degradation azr01100   Metabolic pathways azr01120   Microbial metabolism in diverse environments azr01220   Degradation of aromatic compounds Module azr_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:azr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CJ010_12210    00361 Chlorocyclohexane and chlorobenzene degradation     CJ010_12210    00623 Toluene degradation     CJ010_12210 Enzymes [BR:azr01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CJ010_12210     1.14.13.244  phenol 2-monooxygenase (NADH)      CJ010_12210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  QDF97238 UniProt:  A0A4Y6KSM5 LinkDB All DBs Position 2655974..2656330 Genome browser AA seq 118 aa AA seqDB search MPVTAIKEYVAVPRDQVANFHGKQLVYVSWDRHLLFAAPFLICLPPETPFRELVEGPLKA LVSPDPDAAAIDWQRVEWLKSNQPWTPDFDASLAANGIGHKDQLRMRTAGPNSLAPVA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgcccgtaaccgccatcaaggaatacgtcgccgtgccgcgcgaccaggtcgccaacttc cacggcaagcagctcgtgtatgtgagctgggaccgccacctgctgttcgccgcccccttc ctgatctgcctgccgccggaaaccccgttccgcgagctcgtcgaaggcccgctgaaggcg ctggtctcgcccgacccggatgccgccgccatcgactggcagcgcgtcgaatggctgaaa tccaaccagccgtggacgccggacttcgacgccagcctcgccgccaacggcatcggccac aaggaccagctgcgcatgcgcaccgccggccccaacagcctggccccggtcgcctga

DBGET integrated database retrieval system