Azoarcus sp. DD4: CJ010_13230 Help Entry CJ010_13230       CDS       T06048                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism azr  Azoarcus sp. DD4 Brite KEGG Orthology (KO) [BR:azr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:azr03032]     CJ010_13230    03036 Chromosome and associated proteins [BR:azr03036]     CJ010_13230    03400 DNA repair and recombination proteins [BR:azr03400]     CJ010_13230 DNA replication proteins [BR:azr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CJ010_13230 Chromosome and associated proteins [BR:azr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CJ010_13230 DNA repair and recombination proteins [BR:azr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CJ010_13230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 UBA_HYPK Motif Other DBs NCBI-ProteinID:  QDF97423 UniProt:  A0A4Y6KSU5 LinkDB All DBs Position complement(2880651..2880923) Genome browser AA seq 90 aa AA seqDB search MNKSELIEVIAKDAELSKASAGKALDATIAAVKLALKKNDSVTLVGFGTFYVGERAARTG RNPRTGKSIKIKAAQVPKFRAGKGLKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaaatcagaactgattgaggtcattgccaaggatgccgaactgtccaaggcgtcg gcgggcaaggcgctggatgccacgatcgcagcggttaagttggcgctcaagaagaacgac tccgtcacactggttggttttggtaccttctatgttggcgagcgtgcagcgcgcactggc cgtaacccccgcaccggcaagagcatcaagatcaaggctgcccaagtacccaaattcagg gctggcaaaggcctgaaagatgcagtaaactga

DBGET integrated database retrieval system