Azoarcus sp. DD4: CJ010_15250 Help Entry CJ010_15250       CDS       T06048                                  Name (GenBank) phenol hydroxylase   KO K16245   phenol/toluene 2-monooxygenase (NADH) P4/A4 [EC:1.14.13.244 1.14.13.243] Organism azr  Azoarcus sp. DD4 Pathway azr00361   Chlorocyclohexane and chlorobenzene degradation azr00362   Benzoate degradation azr00623   Toluene degradation azr01100   Metabolic pathways azr01120   Microbial metabolism in diverse environments azr01220   Degradation of aromatic compounds Module azr_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:azr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CJ010_15250    00361 Chlorocyclohexane and chlorobenzene degradation     CJ010_15250    00623 Toluene degradation     CJ010_15250 Enzymes [BR:azr01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CJ010_15250     1.14.13.244  phenol 2-monooxygenase (NADH)      CJ010_15250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_monoox Motif Other DBs NCBI-ProteinID:  QDF97790 UniProt:  A0A4Y6KTU3 LinkDB All DBs Position complement(3318704..3319063) Genome browser AA seq 119 aa AA seqDB search MAIAAIGKYEFAPADALDKFHGAQLLYIGWEDHLLFCAPFAFPFPPTMPFRAIVEQVLPG SFGYHPDFARIDWAKAEWFKSGKPWQPDFDKSLADNGLKHKDVIRFRTPGLTGIAGSCS NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggccatcgctgccatcggcaaatacgaattcgcgcccgccgacgcgctcgacaagttc cacggcgcccaactgctctacatcggctgggaagaccacctgctgttctgcgcccccttc gcctttcccttcccgccgaccatgcccttccgcgccatcgtcgagcaggtgctgccgggg tcgttcggctaccacccggacttcgcccgcatcgactgggccaaggcggagtggttcaag tccggcaagccctggcagccggatttcgacaagtcgctcgcggacaacgggctgaagcac aaggacgtgatccggttccgcaccccggggctgacggggatcgcaggctcctgcagctga

DBGET integrated database retrieval system