Azoarcus sp. DD4: CJ010_15260 Help Entry CJ010_15260       CDS       T06048                                  Name (GenBank) monooxygenase   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism azr  Azoarcus sp. DD4 Pathway azr00361   Chlorocyclohexane and chlorobenzene degradation azr00362   Benzoate degradation azr00623   Toluene degradation azr01100   Metabolic pathways azr01120   Microbial metabolism in diverse environments azr01220   Degradation of aromatic compounds Module azr_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:azr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CJ010_15260    00361 Chlorocyclohexane and chlorobenzene degradation     CJ010_15260    00623 Toluene degradation     CJ010_15260 Enzymes [BR:azr01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CJ010_15260     1.14.13.244  phenol 2-monooxygenase (NADH)      CJ010_15260 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Ubiquitin_5 aRib Motif Other DBs NCBI-ProteinID:  QDF97792 UniProt:  A0A4Y6KV22 LinkDB All DBs Position complement(3320761..3321030) Genome browser AA seq 89 aa AA seqDB search MSTVFIALQTNEDTRPIIEAITADNPHARINEAPAMVKIDAEGKLTVRRSSIEERIGRDF DLQELHINLISLSGNIDETDDELTLSWNA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccaccgtattcatcgcgctgcaaaccaacgaggacacccgcccgatcatcgaggcg atcaccgccgataacccgcacgcccgcatcaatgaggcgccggcgatggtgaagatcgac gccgagggcaagctcaccgtgcgccgttcgagtatcgaggagcgcatcggccgcgacttc gacctgcaggaactgcacatcaacctgatctcgctctccggaaacatcgacgagaccgac gacgaactgacgctgagctggaacgcctga

DBGET integrated database retrieval system