Azoarcus sp. DD4: CJ010_17645 Help Entry CJ010_17645       CDS       T06048                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism azr  Azoarcus sp. DD4 Brite KEGG Orthology (KO) [BR:azr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:azr03110]     CJ010_17645 (grxC) Chaperones and folding catalysts [BR:azr03110]  Protein folding catalysts   Protein disulfide isomerase    CJ010_17645 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like Motif Other DBs NCBI-ProteinID:  QDF99796 UniProt:  A0A4Y6L0J9 LinkDB All DBs Position 3828246..3828497 Genome browser AA seq 83 aa AA seqDB search MYATAVCPYCVRAEQLLRRKGVAEIEKIRIDLDPARRDEMMNLTGRRTVPQIFIGDYHVG GCDDLYELDRSGGLDPLLGASPV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtacgccaccgcggtctgcccgtactgcgtgcgcgccgaacaactgctgcgccgcaag ggcgtcgccgaaatcgagaagatccgcatcgacctcgacccggcccgtcgcgacgagatg atgaacctcaccgggcgccgcacggttccgcaaatcttcattggcgactaccatgtcggc ggctgcgacgacctctacgaactcgaccgcagcggcggcctggaccccttgctcggcgca agccccgtctga

DBGET integrated database retrieval system