KEGG   Azoarcus sp. DD4: CJ010_18545
Entry
CJ010_18545       CDS       T06048                                 

Name
(GenBank) PQQ-dependent dehydrogenase, methanol/ethanol family
  KO
K20937  1-butanol dehydrogenase (quinone) [EC:1.1.5.11]
Organism
azr  Azoarcus sp. DD4
Brite
KEGG Orthology (KO) [BR:azr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CJ010_18545
Enzymes [BR:azr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.11  1-butanol dehydrogenase (quinone)
     CJ010_18545
SSDB
Motif
Pfam: PQQ PQQ_2 PQQ_3 ANAPC4_WD40
Other DBs
NCBI-ProteinID: QDF98393
UniProt: A0A4Y6KVI2
LinkDB
Position
4019517..4021394
AA seq 625 aa
MRTKQPATQLRAVVALVAAALALPAAAATSVSWDDIANDDKTTGDVLSYGLGLKAQRHST
LKQVNTKNVAGLVPAWTFSFGGEKQRGQEGQVLVHDGVIYATASYSRFFAIDARSGKRLW
EYEHRLPDDIRPCCDVVNRGPAIYGDKVFFGTLDASIVALDKATGKVAWKKKFADHKVGY
TMTGAPFIVKDQKSGRILLVHGSSGDEFGVVGWLYARDPDTGEEVWARPLVEGHMGRLAG
KDSTTTGDAKAPSWPNDPNSPTGKVEAWSHGGGAPWQTASFDAENNTIVIGAGNPAPWNT
WKRTAQGDDPQNWDNLFTSGQAYVDASTGELKGFYQHTPNDAWDFSGNNSIILFEYKDPK
TGKQVKASAHADRNGFFFVTDRDKLANGAGYPNKPTSLIGAWPFVDGITWASGFDLKTGK
PIEKGNRPPAPKEGADKGDSVFVSPPFLGGTNWHPMSYSPDTGLFYIPANHWAMDYWTEH
LTYKAGSAYLGQGFRIKKLFEDHVGILRAIDPKSGKIAWEHKEKFPLWAGTLTTAGGLIF
TGTSDGYVKAFDAKNGKELWKFQTGSGVVSVPVTWEMDGEQYIGIQSGYGGAVPLWGGDL
ADLTKQVTQGGSMWVFKLPRQVASR
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgagaaccaagcaacccgcaacccaactgcgcgccgtcgtcgccctggtcgcagccgcg
ctggcactgccggcggcggcggccaccagcgtcagctgggacgacatcgccaacgacgac
aagaccaccggcgacgtgctgtcctacggcctcggcctcaaggcccagcgccacagcacg
ctcaagcaggtgaacacgaagaacgtcgccggcctggtaccggcctggaccttctccttc
ggcggcgagaagcagcgcggccaggaaggccaggtgctggtacacgacggcgtgatctac
gccaccgcctcctattcccgcttcttcgccatcgacgcccgcagcggcaagcgcctgtgg
gagtacgagcaccgcctgcccgacgacatccgtccctgctgcgacgtggtgaaccgcggc
ccggccatctacggcgacaaggtcttcttcggcacgctggacgcttccatcgtggccctc
gacaaggccaccggcaaggtcgcgtggaagaagaagttcgccgaccacaaggtgggctat
accatgaccggcgcgcccttcatcgtgaaggaccagaagagcggcaggatcctgctagtg
cacggctcgtccggcgacgagttcggcgtggtcggctggctgtatgcgcgcgacccggac
accggcgaggaagtgtgggcgcggccgctggtcgaaggccacatgggccggctggccggc
aaggacagcacgacgaccggcgacgccaaggcgccgtcctggccgaacgatccgaattcc
cccaccggcaaggtcgaggcctggagccacggcggcggcgccccctggcagaccgccagc
ttcgacgccgagaacaacaccatcgtcatcggtgccggcaatcccgcgccgtggaacacc
tggaagcgcaccgcgcagggcgacgatccgcagaactgggacaacctcttcacctccggc
caggcctatgtggacgccagcaccggcgagctgaagggcttctaccagcacacgccgaac
gatgcctgggacttctccggcaacaactccatcatcctgttcgagtacaaggacccgaag
accggcaagcaggtgaaggcctcggcgcatgccgaccgcaacggcttcttcttcgtcacc
gaccgcgacaagcttgccaatggcgccggctaccccaacaagccgacctcgctgatcggc
gcctggcccttcgtcgacggcatcacctgggcgtcgggcttcgacctcaagaccggcaag
ccgatcgagaagggcaaccggccgccggcgccgaaggaaggcgccgacaagggcgactcg
gtgttcgtgtcgccgcccttcctcggcggcaccaactggcatccgatgtcctacagcccg
gacaccggcctgttctacatcccggccaaccactgggcgatggactactggaccgagcac
ctgacctacaaggccggctccgcctatctcggccagggcttccgcatcaagaagctgttc
gaggaccacgtcggcatcctgcgtgcgatcgacccgaagagcggcaagatcgcctgggag
cacaaggagaagttcccgctgtgggcaggcacgctgaccaccgccggcgggctgatcttc
accggcacctcggacggctacgtcaaggccttcgacgccaagaacggcaaggagctgtgg
aagttccagaccggctccggcgtggtctcggtgccggtgacctgggagatggacggcgag
cagtacatcggcatccagtccggctacggcggcgcagtgccgctgtggggcggcgacctg
gccgacctcaccaagcaggtcacccagggcggttcgatgtgggtgttcaagctgcccagg
caggtggccagccgctga

DBGET integrated database retrieval system