Azospirillum sp. TSH100: E6C72_12960 Help Entry E6C72_12960       CDS       T09516                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azs  Azospirillum sp. TSH100 Pathway azs01100   Metabolic pathways azs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E6C72_12960    00074 Mycolic acid biosynthesis     E6C72_12960   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E6C72_12960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding AcnX_swivel_put Motif Other DBs NCBI-ProteinID:  QCG88759 LinkDB All DBs Position 2:complement(38132..38365) Genome browser AA seq 77 aa AA seqDB search MDRNEFLLALDEMLELDPGTLTGDETLESLDAWDSLAVISFIALVDEKTGVVVEGEKLAK AKTVGDLLALAGAPVTA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggatcgcaatgaattccttctcgcccttgacgagatgctcgaactggatcccggcacg ctgactggcgacgagaccctggaatcgctggatgcttgggattcgctggcggtcatcagc ttcatcgcgctggtggacgagaagaccggcgtcgttgtggaaggcgagaagctggccaag gccaagacggtcggcgatctgctggccctggcgggtgctccggttacggcctga

DBGET integrated database retrieval system