KEGG   Azospirillum sp. TSH100: E6C72_27385
Entry
E6C72_27385       CDS       T09516                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
azs  Azospirillum sp. TSH100
Pathway
azs02020  Two-component system
azs02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azs00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    E6C72_27385
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    E6C72_27385
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:azs02022]
    E6C72_27385
   02035 Bacterial motility proteins [BR:azs02035]
    E6C72_27385
Two-component system [BR:azs02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   E6C72_27385
Bacterial motility proteins [BR:azs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    E6C72_27385
SSDB
Motif
Pfam: Response_reg cREC_REC PDE8A_N
Other DBs
NCBI-ProteinID: QCG91510
LinkDB
Position
5:complement(430773..431138)
AA seq 121 aa
MKSCLVVDDSRVVRKVARKILEELNFACTEAEDGKQAMEACAAQMPDAILLDWNMPVMTG
IEFLRRLRKMSGGEQPKVVFCTTENDLAHIQEALSAGANEYIMKPFDSDIIQTKFAQVGL
L
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaatcctgcctggtggtcgatgacagccgcgttgtccgcaaggtcgcgcgcaagatc
ctggaagagctgaatttcgcctgcaccgaggcggaggatgggaagcaggcgatggaggcc
tgcgcggcccagatgcccgacgccatcctgctggactggaacatgccggtcatgaccggg
atcgagttcctgcgccggctgcgcaagatgagcgggggcgagcagcccaaggtcgtgttc
tgcaccaccgagaacgacctcgcccacatccaggaggcgctgtccgccggggccaacgag
tacatcatgaagcccttcgacagcgacatcatccagaccaagttcgcgcaggtcggcctt
ctctga

DBGET integrated database retrieval system