Azospirillum thermophilum: DEW08_04335 Help Entry DEW08_04335       CDS       T05917                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism azz  Azospirillum thermophilum Pathway azz00998   Biosynthesis of various antibiotics azz01100   Metabolic pathways azz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DEW08_04335    00074 Mycolic acid biosynthesis     DEW08_04335   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DEW08_04335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AWK85495 UniProt:  A0A2S2CLV8 LinkDB All DBs Position 1:complement(973507..973740) Genome browser AA seq 77 aa AA seqDB search MDRKDFLLALDEMLELDAGTLTGDEVLETLENWDSLAVISFIALVDEKLGVVLEGEKLAK AKTVSDLLALAGVAVAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggatcgtaaggacttcctgctcgctcttgacgagatgctcgaactcgatgccggcacc ctgaccggcgacgaggtgctggagacgctggaaaactgggattcgctggcggtcatcagc ttcatcgcactggtcgacgagaagctaggcgtggtgctggaaggcgagaagctggcgaag gccaagacggtgtccgatctcctggcgctggccggcgtcgccgtcgctgcgtga

DBGET integrated database retrieval system