Azospirillum thermophilum: DEW08_07830 Help Entry DEW08_07830       CDS       T05917                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism azz  Azospirillum thermophilum Brite KEGG Orthology (KO) [BR:azz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:azz03110]     DEW08_07830 (grxC) Chaperones and folding catalysts [BR:azz03110]  Protein folding catalysts   Protein disulfide isomerase    DEW08_07830 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 SH3BGR Glrx-like GST_N Thioredoxin_2 Thioredoxin_3 Bac_GH3_C Motif Other DBs NCBI-ProteinID:  AWK86175 UniProt:  A0A2S2CP18 LinkDB All DBs Position 2:complement(370275..370538) Genome browser AA seq 87 aa AA seqDB search MAEVVIYTTPFCPYCSRAKRLLDSKGVSYEEIDLYMHPGRRDEMVQRAEGRTTVPQIFID GKPYGGCDDIHALDRAGKLDPVLGLGA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggccgaggtcgtcatctacaccacccccttctgcccctactgctcgcgcgccaagagg ctgctggacagcaagggcgtgtcctacgaggagatcgacctctacatgcatcccggccgg cgcgacgagatggtgcagcgggcggaggggcgcacgaccgttccgcagatcttcatcgac ggcaagccctatggcggctgcgacgacatccacgcgctcgaccgcgccggcaagctcgac ccggtcctgggactcggtgcatga

DBGET integrated database retrieval system