Azospirillum thermophilum: DEW08_08390 Help Entry DEW08_08390       CDS       T05917                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azz  Azospirillum thermophilum Pathway azz00998   Biosynthesis of various antibiotics azz01100   Metabolic pathways azz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DEW08_08390    00074 Mycolic acid biosynthesis     DEW08_08390   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DEW08_08390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AWK87926 UniProt:  A0A2S2CTX3 LinkDB All DBs Position 2:487309..487560 Genome browser AA seq 83 aa AA seqDB search MMLSRDEIYEKLKGYLEDMFEVPPERVSLEARLFDDLDLDSIDAVDLVVKLQELTGRKFK PEEFKSVRTVGDILDRVHALLAV NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtgatgctctcgcgcgacgagatctacgagaagctgaagggctacctggaagacatgttc gaggtgcctccggaacgcgtgtcgctggaggcgcgcctgttcgacgacctggacctggac agcattgatgcggtcgacctcgtggtgaagctccaggagctgacgggccgtaagttcaag cctgaggagttcaagagcgtccgcaccgtcggcgacattctcgaccgggtgcatgcgctg ctcgcggtttaa

DBGET integrated database retrieval system