Azospirillum thermophilum: DEW08_13770 Help Entry DEW08_13770       CDS       T05917                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism azz  Azospirillum thermophilum Pathway azz00998   Biosynthesis of various antibiotics azz01100   Metabolic pathways azz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:azz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DEW08_13770    00074 Mycolic acid biosynthesis     DEW08_13770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DEW08_13770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AWK87151 UniProt:  A0A2S2CRK8 LinkDB All DBs Position 2:complement(1588850..1589089) Genome browser AA seq 79 aa AA seqDB search MSDIAERVKKIVVEHLGVEEAKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFINANSAS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgccgagcgcgtgaagaagatcgtggtggagcacctgggtgtggaagag gcgaaggtgacggagaacgcctccttcatcgacgacctcggcgccgacagcctggatacc gtcgagctggtcatggccttcgaggaagagttcggctgcgagattccggacgacgccgcg gagaagatcctgacggtgaaggacgccatcgacttcatcaatgcgaactccgcctcctga

DBGET integrated database retrieval system