Brucella abortus BDW: DK48_1634 Help Entry DK48_1634         CDS       T03462                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism babb  Brucella abortus BDW Pathway babb01100   Metabolic pathways babb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:babb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DK48_1634 (acpP)    00074 Mycolic acid biosynthesis     DK48_1634 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DK48_1634 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AIJ52530 UniProt:  A0AAE9IKG3 LinkDB All DBs Position 1:complement(1653475..1653711) Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system