Brucella abortus bv. 2 86/8/59: DK55_1039
Help
Entry
DK55_1039 CDS
T03321
Name
(GenBank) hypothetical protein
KO
K06918
uncharacterized protein
Organism
babo
Brucella abortus bv. 2 86/8/59
Brite
KEGG Orthology (KO) [BR:
babo00001
]
09190 Not Included in Pathway or Brite
09194 Poorly characterized
99997 Function unknown
DK55_1039
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
DUF463
DO-GTPase2
MeaB
TetR_C_24
GTP_EFTU
Motif
Other DBs
NCBI-ProteinID:
AIJ91885
LinkDB
All DBs
Position
1:complement(1038153..1039613)
Genome browser
AA seq
486 aa
AA seq
DB search
MAKLTSFGDEARIALDTLTDRATGLLSPSLRLGVTGLSRAGKTVFISALVHNLVHGGRLP
MFEAYKAGRISRALLEPQPDDAVPRFQYEEHLSALIDERIWPDSTRAISQLRLTIEYETA
SAWGRWLSPGRLSVDIVDYPGEWLLDLPLLGKTYAQFSADSFALANEPTHRDLAAAWLAE
AKTVAPSEKADELTAQRLARCFTDYLRAGKADERALSTLPPGRFLMPGDLDGSPALTFAP
LPDLEPGDFKSGSMAAMMERRYEAYKTYVVKPFFREHIARLDRQIVLIDAMQAMNAGGAV
VADLERALTDILSCFRPGRSNLLTGLIQRRIGRILVAATKADHLHHESHDRLQAIVRRLV
ERAIERADFSGADIDVLAMAAVRTTREATVTEGNETLPVIVGTPLKGERIDGEVFDGETE
TAIIPGDLPKNPNVIFDPALSQDEPAIRFVRFRPPRLERTAEGVTLSLPHIRLDRALQFL
IGDRLA
NT seq
1461 nt
NT seq
+upstream
nt +downstream
nt
ttggcaaaactgaccagtttcggcgatgaagcaaggatcgcgctggatacgctgacagac
cgggcgacaggccttctttccccatcgcttcgattgggcgttaccggcctttcgcgcgca
ggcaagacggttttcatcagtgcgcttgtgcataatctggtgcatggcggacgcctgccc
atgttcgaggcttataaagccgggcgcatttcacgggcactcctcgaaccacagccggat
gatgccgtgccgcgctttcaatatgaagagcacctttcggcgctgatcgacgaacgtatc
tggccggattccacacgcgccatttcgcagttgcgccttacgattgaatatgagacggct
tccgcctgggggcgctggctctcgccggggcgtctttcggtcgatattgtcgattatccc
ggcgaatggctgcttgatcttcccctgcttggaaaaacctatgcacaattcagcgcggat
tcctttgcactcgccaacgagccgacgcacagggaccttgcggctgcatggctggccgag
gcgaagacggttgccccttccgaaaaggccgatgaactgaccgcacagcgccttgcccgg
tgctttaccgactatctgcgcgcaggcaaagcggatgagcgcgcgctttccaccttgccg
cccggccggtttttaatgccgggtgatctggacggctcgcctgcactcaccttcgcgccg
ctacccgaccttgagccgggtgattttaaatccggttcgatggccgccatgatggagcgg
cgctacgaagcctacaaaacctatgtcgtaaagccctttttccgcgagcatattgcacgt
ctcgaccggcagatcgttctgatcgacgcgatgcaggcgatgaatgctggcggcgcggtc
gtggccgatctggagcgcgccctgaccgacattctatcctgtttccgtcccggcaggtcc
aatctgctgaccggccttatccagcgccgcattggccgcattctcgtcgcggcaacgaaa
gccgatcatctgcaccatgaaagccatgaccgcttgcaagccatcgtgcggcgattggtg
gaacgcgccatagagcgggccgatttttcaggggcggatatcgatgtgcttgccatggca
gcggttcgcaccacgcgggaggccacagtgacggagggtaacgaaaccctgcccgttatt
gtcggcacacctttgaagggggagcgcattgatggagaagtcttcgatggtgaaacagaa
acagctataattcccggtgatttaccaaaaaatcctaatgtaatttttgaccctgcattg
tcacaggatgaaccggcaatccgtttcgttcggttccgcccgcccaggctggagcgaacc
gccgaaggcgtaaccttgtccttgccgcatattcggctcgaccgggcgctgcaattcctg
attggggatcgtctggcatga
DBGET
integrated database retrieval system