Brucella abortus bv. 2 86/8/59: DK55_2691 Help Entry DK55_2691         CDS       T03321                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism babo  Brucella abortus bv. 2 86/8/59 Pathway babo00190   Oxidative phosphorylation babo01100   Metabolic pathways babo02020   Two-component system Module babo_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:babo00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DK55_2691  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DK55_2691 Enzymes [BR:babo01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DK55_2691 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AIJ91503 LinkDB All DBs Position 2:complement(625131..625286) Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctaaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system