KEGG   Brucella abortus BER: DK51_955
Entry
DK51_955          CDS       T03685                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
babs  Brucella abortus BER
Pathway
babs00260  Glycine, serine and threonine metabolism
babs00750  Vitamin B6 metabolism
babs01100  Metabolic pathways
babs01110  Biosynthesis of secondary metabolites
babs01120  Microbial metabolism in diverse environments
babs01230  Biosynthesis of amino acids
Module
babs_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:babs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DK51_955 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DK51_955 (thrC)
Enzymes [BR:babs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DK51_955 (thrC)
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C
Other DBs
NCBI-ProteinID: AIJ55706
UniProt: A0AAE9IID8
LinkDB
Position
1:966503..967894
AA seq 463 aa
MKYVSTRGEAPVLGFSDALLAGLARDGGLYLPQEYPQFTAEQIRALRGKSYVEVALAVLT
PFTGGEIPAADFERMVREAYGTFRHDAVCPLVQTDANEFVLELFHGPTLAFKDVAMQLLA
RMMDYVLAQRGERATIVGATSGDTGGAAIEAFGGRDNTDIFILFPNGRVSPVQQRQMTSS
GFSNVHALSIEGNFDDCQNLVKGMFNDLEFCDALSLSGVNSINWARIMPQVVYYFTAALS
LGAPDRAVSFTVPTGNFGDIFAGYVAKRMGLPIEQLIIATNDNDILSRTLESGAYEMRGV
AQTTSPSMDIQISSNFERLLFEAHGRDAAAVRGLMQGLKQSGGFTISEKPLSAIRSEFSA
GRSTVDETAATIESVLSKDGYLLDPHSAIGVKVAREKASGTAPMVVLATAHPAKFPDAVK
AACGVEPQLPAWLCDLMQRKESFTVLHNELKIVEEYVRHHSRA
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgaaatatgtaagtacgcgtggggaagcaccggttctgggattcagcgatgcattgctc
gcaggcctcgcccgtgatggcggtctttatctgccgcaggaatatccgcaattcacagcc
gaacagatccgcgccctgcgtggaaaatcctatgtcgaagtcgcgctggccgtcctcacg
ccctttaccggcggtgaaattccggcagccgatttcgagcgcatggtccgcgaagcttac
ggaaccttccgtcacgatgccgtctgcccgttggtgcagaccgacgcgaacgaattcgtg
ctggagcttttccatggccccacccttgccttcaaggatgtcgccatgcagcttctggcc
cgcatgatggattatgttctggcacagcgcggcgagcgcgcaacgatcgtcggcgctaca
tccggcgatacgggcggcgcagccatcgaagcctttggcgggcgcgacaacacagacatt
ttcatcctgttccccaatgggcgggtctcgccggtacagcaacgccagatgacgtcttcc
ggcttttccaatgtccatgcgctttccatcgagggcaatttcgacgattgccagaacctc
gtaaaaggcatgttcaatgatctggaattctgtgacgccctgtcgctttccggcgtgaac
tcgatcaactgggcgcgcatcatgccgcaggttgtctattatttcacggcagcactcagc
ctcggcgcaccggaccgcgccgtgtccttcacggtgcccaccggcaatttcggcgatatt
ttcgcaggctacgtcgccaagcgcatgggcctgcccatcgagcaactcatcatcgccacc
aacgacaacgatattctttcgcgcacgctggaaagcggggcctatgagatgcgcggcgta
gcgcagaccacttcgccctcaatggatatccagatttcctccaatttcgagcggcttctg
ttcgaggcacacgggcgcgatgcggcggccgtgcgcgggctgatgcagggcctgaagcaa
tctggcggatttacgatttccgaaaagccgctttcggccatccgcagcgaattttcggct
ggccgctccaccgtcgatgagacggcggcgactatcgaatcggttctttccaaagacggc
tatctgcttgatccgcattcggcgatcggtgtgaaggtcgcgcgtgaaaaagcatccggc
accgccccgatggtggttctggcgaccgcccatccggccaaattcccggatgcggtgaag
gctgcatgtggggtcgagccgcaattgccggcatggctttgcgacctgatgcaacgaaaa
gaaagcttcacagttcttcacaacgagctgaaaatcgtggaagaatatgtgcgccaccat
tcccgagcctga

DBGET integrated database retrieval system