Brucella abortus 63 75: DK49_2547 Help Entry DK49_2547         CDS       T03461                                  Name (GenBank) cyd operon protein YbgT   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism babt  Brucella abortus 63 75 Pathway babt00190   Oxidative phosphorylation babt01100   Metabolic pathways babt02020   Two-component system Module babt_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:babt00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     DK49_2547  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     DK49_2547 Enzymes [BR:babt01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      DK49_2547 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Hemotin Motif Other DBs NCBI-ProteinID:  AIJ79342 UniProt:  A0AAE9LF15 LinkDB All DBs Position 2:480740..480895 Genome browser AA seq 51 aa AA seqDB search MWYFSWLLGLPLAAAFAVLNAMWYELMDDRARKRLAADPTAELALEGNKHH NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttttcctggcttttgggcctgccgcttgcagccgcgttcgctgtgctaaat gcgatgtggtatgagctgatggacgaccgggcgcgcaagcgccttgccgccgaccccacg gcggaactggcccttgaaggcaacaagcaccactga

DBGET integrated database retrieval system