Brucella abortus 63 75: DK49_255 Help Entry DK49_255          CDS       T03461                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism babt  Brucella abortus 63 75 Pathway babt01100   Metabolic pathways babt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:babt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DK49_255 (acpP)    00074 Mycolic acid biosynthesis     DK49_255 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DK49_255 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AIJ80364 UniProt:  A0AAE9IKG3 LinkDB All DBs Position 1:244709..244945 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system