KEGG   Brucella abortus 63 75: DK49_291
Entry
DK49_291          CDS       T03461                                 
Symbol
smc
Name
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
babt  Brucella abortus 63 75
Brite
KEGG Orthology (KO) [BR:babt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:babt03036]
    DK49_291 (smc)
Chromosome and associated proteins [BR:babt03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    DK49_291 (smc)
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_21 SMC_hinge AAA_15 ABC_tran AAA_29 AAA SHE3
Other DBs
NCBI-ProteinID: AIJ81136
UniProt: A0AAE9ILR1
LinkDB
Position
1:281486..284944
AA seq 1152 aa
MRFSRLRLVGFKSFVEPMEFVIEGGLTGVVGPNGCGKSNLVEALRWVMGENSYKNMRASG
MDDVIFSGSATRPARNTAEVTLFLDNSDRTAPPAYNDADELQVSRRIEREAGSLYRINGK
EARAKDVQLLFADQSTGARSPSMVGQGRIGELIQAKPQARRALLEEAAGISGLHTRRHEA
ELRLRAAETNLERLDDVVGELGSQIESLKRQARQANRFKSLSADIRRAETALLHLRWNVA
KGQEAEAQSALSQATATVGDMAEAQMKAARDQAVGAHKLPELREAEAGAAAALQRLSIAR
TQLDEEGERIRARRAELMKRLEQLTADIAREEQMLRENADILARLDEEEQELAASSEASG
ERNEELRALFEEAEIRLQDSESALARLTAERAEAAAERAQVERALKEAQDRRDRLAVQME
NIERDIAAVVGQIGGLFDPAEKRIVVDACTQALEAAEEAVVAAEELVAHAREAEAASRQP
LSEARTELNRIETEAQTLARILNAGETGQFPPVVEELRVEKGYEVALGAALGEDLDAASD
ENAPVYWAYNPAAETDPALPEGAMPLDRLVDGPQQLRRRLAQVGVVSEADGRRLQVGLRP
GQRLVSKTGALWRWDGYTASADAPTPAAQRLAQKNRLAELEQDAIGARRRVEDAGQAVER
AEAAVRKAVEDERVARDQWRANQRKLDEAREALAAAERAAGELATRRSALDESRARLEEN
LEEAQIRVAEAGDRLGEMPDMDAIAQRLSALTSEVQSDRAALAEARAAYEGLRREADARL
RRLEMIALERRNWISRAENADRHIAALNDRRAETAEEAEVLAEAPDEIENRRRALLNELS
LAEERRRAAADILAEAETRQAELDKAATLAIQHLAASREQRARAEERLTAAQERRKDAEA
RIFEALNCPPHEAIRHAGLKPEDAMPDPDQLERQLERLKIERERLGAVNLRAEEESRELS
DRLDALISEREDVIEAIKKLRQAIQSLNREGRERLLAAFDVVNAQFQRLFTHLFGGGTAE
LQLIESDDPLEAGLEILARPPGKKPQTMTLLSGGEQALTAMALIFAVFLTNPAPICVLDE
VDAPLDDHNVERYCNLMDEMAASTETRFVVITHNPITMARMNRLFGVTMGEQGVSQLVSV
DLQTAEQLREAS
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgcgcttctccaggctgcgccttgtcgggttcaaatccttcgtcgagccgatggagttc
gtcatcgaaggcgggcttacaggcgttgtcggccccaatgggtgcggcaagtccaatctg
gtggaagccctgcgctgggtaatgggtgaaaactcctacaagaacatgcgcgcttccggt
atggacgatgtgattttttccggttccgcgacgcggcccgcgcgcaatacggcggaagtg
acgctttttctcgacaattccgaccgtacggccccacccgcctataacgacgcggatgaa
ttgcaggtgtcgcgccgcatcgagcgtgaggccgggtcgctctaccgcatcaatggcaag
gaagcacgcgccaaggatgtgcagcttttatttgccgatcaatccaccggtgcgcgctcg
ccttccatggtggggcaggggcgtatcggcgagttgatacaggcaaaaccgcaggcgcgc
cgtgcgcttctggaagaggcggcgggcatttccggcctgcacacgcgccgccatgaggcg
gaactgcggctgcgcgcggctgaaaccaatctggagcggctggatgatgtggtgggcgaa
ctgggcagccagattgaaagcctgaaacgccaggcacgccaggccaatcgcttcaaatcg
ctttccgcagatatccgccgcgccgaaacagccttgttgcacctgcgctggaatgtggcc
aaagggcaggaggccgaggcgcagagcgcgctgtcgcaggcgaccgcgaccgttggcgat
atggccgaagcgcagatgaaagccgcgcgcgatcaggctgtcggcgcgcataaattgccg
gaattgcgtgaggcggaggccggggctgccgcagccttgcagcgtctttccattgcgcgc
acgcaactggacgaggagggtgagcgcattcgcgcccgccgtgccgaactgatgaagcgg
ctggagcaactgactgcggatatcgcgcgcgaagaacagatgttgcgcgaaaatgccgat
attctggcccggcttgatgaggaggagcaggaactggccgcttccagcgaggcatccggt
gaacgcaatgaggaattgcgcgcgctgttcgaggaagcggaaatccgcttgcaggatagc
gaaagcgcgcttgcccgcttgacggcggagcgggcggaagccgctgccgagcgcgcgcag
gtcgagcgggcgctgaaggaagcgcaggaccggcgtgaccgtctggccgtgcagatggaa
aatatcgagcgcgatatcgcagccgtggttggacagatcggcggtctgttcgatccggcg
gaaaagcgcatcgtggtggatgcctgtacgcaagccctggaagcggccgaagaagcggtt
gtcgcggcggaagaactggtcgcccatgcgcgcgaggcggaagccgcaagccgccagccc
ttgagcgaagcgcgcacggaattgaaccgtatcgaaaccgaggcacagacgctggcgcgc
attctcaatgcgggcgagacaggccaattcccgccggtcgtcgaggaattgcgcgtcgaa
aagggctatgaagtggcgcttggcgcggctttgggcgaagatctcgatgcggcaagcgat
gagaatgcgccggtttactgggcctataatcccgctgccgaaaccgatccggccttgccg
gaaggggccatgccgctcgatcgcctggtggatggcccacagcaattgcgccgcaggctg
gcacaggtgggcgtggtttcggaagcggacggcaggcgtttgcaggtaggcctgagaccg
gggcaaaggcttgtgagcaagacaggcgcgctctggcgctgggacggctatacggcgagc
gccgatgcgcctacgcctgccgcgcagcgtctggcgcagaagaaccggcttgccgaactg
gaacaggatgcaatcggcgcgcgcaggcgcgtggaagatgccgggcaggcggtggaacgc
gcggaagcggcagtgcgcaaggccgttgaggacgagcgcgtggcgcgcgatcaatggcgt
gccaaccagcgcaagctggatgaggcgcgtgaagcactggccgcagccgagcgcgcggca
ggtgagcttgcaacgcgccgctccgcgctggatgaatccagggcgcgtctggaagaaaat
cttgaagaagcgcagatccgtgttgcggaagccggggatcgccttggcgaaatgccggat
atggatgcgattgcccagcgcctttcggcgctgacgagtgaggtgcagtccgaccgcgcg
gcgcttgccgaggcgcgggccgcctatgaaggacttcgccgcgaggccgatgcgcggttg
cgccgccttgaaatgattgcactggaacgccgcaactggatttctcgtgccgaaaatgcc
gatcgccacatcgctgcattgaacgaccgccgggcggaaaccgccgaagaagccgaggtg
ttagcggaagcgcctgacgaaatcgaaaaccgccgccgggcacttttaaacgagctttcg
ctggcggaagagcgtcgcagggcggcggcggatattctggcggaagcggaaacccggcag
gcggaactcgacaaggcggccacgcttgcgatccagcatcttgccgcaagccgcgagcag
cgcgcgcgcgccgaagaacggctgaccgcagcgcaggagcgccgcaaggatgccgaagcg
cgtatttttgaagccttaaactgtccgccgcatgaagcgatccgccatgccggtctgaag
ccggaagacgccatgccggacccggaccagcttgagcgccagttggaacggctgaagatc
gagcgcgagcgtctgggcgcggtgaacctgcgcgcggaggaggagagccgggagctttcg
gaccgtctcgacgcgcttatctccgagcgtgaggatgtgattgaggcgatcaagaagctg
cgtcaggcaatccagagcctgaaccgcgaaggacgcgaacgtttgctggcggcattcgat
gtggtgaatgcgcagttccagcgcctattcacgcatctgttcggtggcggtacggcggaa
ctgcaactgatcgaaagcgatgatccgctggaagccgggcttgaaattcttgcccgcccg
cccggcaagaagccgcagacgatgacgctgctttccggcggtgagcaggcattgaccgcc
atggcgttgatttttgcggtcttcctcaccaatcccgcgccgatctgcgtgctggacgaa
gtggacgcgccgctcgacgaccataatgtcgaacgctattgcaacctgatggacgaaatg
gcggcttcgaccgaaacgcgcttcgtcgtcatcacacataatccgatcaccatggcgcgc
atgaaccgcctgttcggtgtgaccatgggtgagcaaggggtgagccagcttgtctcggtc
gatcttcaaacggcggagcagctacgcgaggcaagttga

DBGET integrated database retrieval system