Brucella abortus bv. 9 C68: DK53_482 Help Entry DK53_482          CDS       T03474                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism babu  Brucella abortus bv. 9 C68 Pathway babu01100   Metabolic pathways babu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:babu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DK53_482 (acpP)    00074 Mycolic acid biosynthesis     DK53_482 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DK53_482 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AIJ61511 LinkDB All DBs Position 1:492517..492753 Genome browser AA seq 78 aa AA seqDB search MSDTAERVKKIVVEHLGVDADKVTEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVKFIDKASA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgataccgcagagcgcgtcaagaaaatcgttgttgaacatctgggcgtagatgcc gacaaggtcacggaaggcgcaagcttcattgatgacctcggcgcagacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggcgttgaaattcctgacgacgctgcc gaaacgatccttacggtcggtgatgctgtgaagttcatcgataaggcttctgcctga

DBGET integrated database retrieval system