Bacillus sp. BH072: OY17_09940 Help Entry OY17_09940        CDS       T03582                                  Name (GenBank) transcriptional regulator   KO K06315   transcriptional regulator of the spore photoproduct lyase operon Organism bacb  Bacillus sp. BH072 Brite KEGG Orthology (KO) [BR:bacb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bacb03000]     OY17_09940 Transcription factors [BR:bacb03000]  Prokaryotic type   Other transcription factors    Others     OY17_09940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SplA Phage_g100 Motif Other DBs NCBI-ProteinID:  AJE78397 LinkDB All DBs Position 1943839..1944078 Genome browser AA seq 79 aa AA seqDB search MTKSFAAGDTVYVIYRNPHAANVAHIKEAEIVHHPYHEGELSLFLYETYHPLAEDDAVFS TYEEAEALYSELFEEDRYH NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgacaaaatcatttgcagcgggggatacggtctatgtgatttaccgcaatccgcatgcc gccaatgttgcccatattaaagaggcggagatcgtccatcacccgtatcacgagggagaa ctgtctctgtttttatacgaaacctatcatccgctggccgaagatgacgcggtcttttcg acatatgaggaagcggaagcgctttacagcgagctttttgaagaagaccgatatcattga

DBGET integrated database retrieval system