Bacillus sp. 1NLA3E: B1NLA3E_12350 Help Entry B1NLA3E_12350     CDS       T02643                                  Name (GenBank) transcriptional regulator splA   KO K06315   transcriptional regulator of the spore photoproduct lyase operon Organism baci  Bacillus sp. 1NLA3E Brite KEGG Orthology (KO) [BR:baci00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:baci03000]     B1NLA3E_12350 Transcription factors [BR:baci03000]  Prokaryotic type   Other transcription factors    Others     B1NLA3E_12350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SplA Motif Other DBs NCBI-ProteinID:  AGK54218 UniProt:  N0AU57 LinkDB All DBs Position 2724058..2724315 Genome browser AA seq 85 aa AA seqDB search MKIVLDTIEPQNMRARDEVFVLYHNPHTPSVVNIKPAEIVQHPKDPDKLALFLNESFHLI EEDDALYSTEAAAEKAFAEFYSELY NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaaatcgttttggatacaattgaacctcaaaatatgcgggctagggacgaagtattt gttctgtaccataatcctcacacaccctccgtcgtcaatataaaaccggcagagattgtt caacacccaaaggatccagacaaattggccttgtttttaaatgagtcattccatttaatt gaagaagatgatgctctttattcaacagaagctgctgcagaaaaggcttttgctgaattt tacagtgaattatattaa

DBGET integrated database retrieval system