Bacillus sp. 1s-1: CJO35_08570
Help
Entry
CJO35_08570 CDS
T11357
Name
(GenBank) stage V sporulation protein E
KO
K03588
peptidoglycan glycosyltransferase [EC:
2.4.99.28
]
Organism
bacj Bacillus sp. 1s-1
Pathway
bacj00550
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:
bacj00001
]
09100 Metabolism
09107 Glycan biosynthesis and metabolism
00550 Peptidoglycan biosynthesis
CJO35_08570
09180 Brite Hierarchies
09181 Protein families: metabolism
01003 Glycosyltransferases [BR:
bacj01003
]
CJO35_08570
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
bacj01011
]
CJO35_08570
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
bacj03036
]
CJO35_08570
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bacj02000
]
CJO35_08570
Enzymes [BR:
bacj01000
]
2. Transferases
2.4 Glycosyltransferases
2.4.99 Transferring other glycosyl groups
2.4.99.28 peptidoglycan glycosyltransferase
CJO35_08570
Glycosyltransferases [BR:
bacj01003
]
Polysaccharide
Bacterial polysaccharide (excluding LPS)
CJO35_08570
Peptidoglycan biosynthesis and degradation proteins [BR:
bacj01011
]
Peptidoglycan biosynthesis and degradation
Glycosyltransferase
CJO35_08570
Chromosome and associated proteins [BR:
bacj03036
]
Prokaryotic type
Chromosome partitioning proteins
Divisome proteins
CJO35_08570
Transporters [BR:
bacj02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
CJO35_08570
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Other DBs
NCBI-ProteinID:
ASV15207
LinkDB
All DBs
Position
1659423..1660523
Genome browser
AA seq
366 aa
AA seq
DB search
MQTKKTSPDFLLVIITLLLLTIGLIMVYSASAVWATYKYDDSFFFAKRQLLFAGIGVIAM
FFIMNVDYWTWRTYAKILIIVCFFLLIIVLVPGIGMERNGSRSWIGVGAFSIQPSEFMKL
AMIAFLAKFLSEKQKNITSFRKGFVPALGIVFSAFLIIMMQPDLGTGTVMVGTCIIMIFV
AGARISHFVFLGLIGLSGFVGLVLSAPYRIKRITSYLNPWEDPLGSGFQIIQSLYAVGPG
GLFGLGLGQSRQKFFYLPEPQTDFIFAILSEELGFIGGSLILLLFSVLLWRGIRIALGAP
DLYGSFVAVGVISMIAIQVMINIGVVTGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNV
SRYSRY
NT seq
1101 nt
NT seq
+upstream
nt +downstream
nt
ttgcaaacaaaaaaaacgtcaccggattttttgctggttatcattacgctattgctttta
acaatcggactgattatggtatacagcgccagtgcagtatgggcgacttacaaatacgac
gactcctttttctttgcgaaacggcagcttttgtttgccggcatcggggtcatcgccatg
tttttcatcatgaacgtcgactactggacgtggaggacttatgcgaaaatactgatcatt
gtatgtttctttctgctcatcatcgtcctggttcccgggatcggcatggaacggaacggg
tcgaggagctggatcggagtcggcgctttcagcattcagccgtccgagtttatgaaactc
gcgatgatcgcatttttggccaagtttttatctgaaaagcaaaagaatattacgtcgttt
agaaaaggctttgtgccggcgctgggcattgtcttttcagcttttctgatcatcatgatg
cagcctgacctcggaacaggaaccgtgatggtcggcacatgcatcattatgatctttgtc
gcgggggcgagaatttcgcacttcgtttttctcggcctgatcggactgagcggttttgtc
ggccttgtgctgtcggcgccgtaccggatcaaaaggatcacttcatacttgaacccttgg
gaggaccctttaggaagcggctttcaaatcattcagtctctttatgcggtggggcccggc
gggctgttcggcctcggcctcggccagagcaggcaaaagttcttctatctgcctgagccg
cagacagattttatttttgcgattttatcagaggagctcggctttatcggcggatcgctg
attcttttgctcttcagcgttctattatggagaggcatcagaatcgcgctcggtgcgccc
gatttatacggcagttttgtcgccgtcggcgtcatttcgatgatagcgattcaggttatg
atcaatatcggagtcgtgactggcttgattcctgttacaggcattacgcttccgttttta
agctatggcggttcatcactgaccttgatgctcatggcggtcggcgtgctgctgaatgtc
agcaggtattctagatactag
DBGET
integrated database retrieval system