Bacillus sp. BS34A: BS34A_07970
Help
Entry
BS34A_07970 CDS
T03833
Symbol
yesP
Name
(GenBank) ABC transporter permease
KO
K25677
pectin-derived oligosaccharide transport system permease protein
Organism
bacl
Bacillus sp. BS34A
Brite
KEGG Orthology (KO) [BR:
bacl00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
bacl02000
]
BS34A_07970 (yesP)
Transporters [BR:
bacl02000
]
ABC transporters, prokaryotic type
Saccharide, polyol, and lipid transporters
Pectin-derived oligosaccharide transporter
BS34A_07970 (yesP)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
Motif
Other DBs
NCBI-ProteinID:
CEJ76262
LinkDB
All DBs
Position
I:762921..763850
Genome browser
AA seq
309 aa
AA seq
DB search
MTGNGADAMKKSRSIRKDNLAGYAFISPFIIGFLCFTVIPMGASLFLSFTSYDLFTAPKW
IGLDNFKEMFTGDEKYWQSLKVTFTYVLAGVPLRLGFALFIAVILNNAAKGTAIYRTLFY
LPSIIGGSVAVAIMWRNIFGNDGVINALLFFVGIDQKILWYQNPTSALWTLILLSVWQFG
SSMLIFLAGLKNIPSSYLEAASVDGANRVQRFFKITLPILTPIIFFNLVMQTISAFMTFT
PAYIISKGEGGPLDGTLLYSLYLFQRAFNYFQMGYASAMAWVMLVIVGLITLILFKTSSY
WVHYESKEE
NT seq
930 nt
NT seq
+upstream
nt +downstream
nt
ttgacgggaaatggggctgacgcaatgaaaaaaagccggagtataagaaaagacaatctg
gcgggatatgcttttatttctccgtttatcatcgggttcctatgctttacggtgattccg
atgggggcgtccctgtttctgtccttcacgagctatgacttgtttacggcgccgaaatgg
atcgggctcgacaactttaaggaaatgtttacgggtgacgaaaagtattggcagtctctg
aaggtgacgtttacgtatgtgcttgccggggttccgctccgcctcggcttcgcgcttttt
atcgctgtcattttaaacaatgcagcaaaaggaacggccatttacagaacgctcttttat
ctgccttcgatcatcggcgggagcgtcgccgtggcgattatgtggcgcaatatttttggc
aatgacggggtcatcaatgcgctgctgttttttgtcgggattgatcaaaaaattctttgg
taccagaatccgacaagtgcgctgtggacattgattctgctgtccgtctggcagttcggg
tcgtcaatgctgatttttttggccgggctgaaaaacattccgtcttcgtatttggaagcg
gcaagtgtggatggggcaaatcgggtgcagcgtttcttcaagatcacgcttccgatcctt
acaccgattattttctttaacctagtgatgcagacgatttctgcttttatgacatttaca
cctgcctatatcatttcgaagggcgagggcgggccgcttgacgggacacttctctattcg
ctctatttgttccagcgtgcgtttaactattttcaaatgggctacgcatcggcgatggcg
tgggtcatgcttgtcattgtcgggctgattacgctcatattgtttaaaacatcgtcatat
tgggttcattacgagtcaaaggaggaatga
DBGET
integrated database retrieval system