KEGG   Bacillus sp. BS34A: BS34A_32830
Entry
BS34A_32830       CDS       T03833                                 
Symbol
bioI
Name
(GenBank) biotin biosynthesis cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bacl  Bacillus sp. BS34A
Pathway
bacl00780  Biotin metabolism
bacl01100  Metabolic pathways
bacl01240  Biosynthesis of cofactors
Module
bacl_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bacl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BS34A_32830 (bioI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bacl00199]
    BS34A_32830 (bioI)
Enzymes [BR:bacl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     BS34A_32830 (bioI)
Cytochrome P450 [BR:bacl00199]
 Cytochrome P450, bacteria type
  CYP107 family
   BS34A_32830 (bioI)
SSDB
Motif
Pfam: p450 Cas_Cas5d
Other DBs
NCBI-ProteinID: CEJ78671
LinkDB
Position
I:complement(3107236..3108423)
AA seq 395 aa
MTIASSTASSEFLKNPYSFYDTLRAVHPIYKGSFLKYPGWYVTGYEETAAILKDARFKVR
TPLPESSTKYQDLSHVQNQMMLFQNQPDHRRLRTLASGAFTPRTTESYQPYIIETVHHLL
DQVQGKKKMEVISDFAFPLASFVIANIIGVPEEDREQLKEWAASLIQTIDFTRSRKALTE
GNIMAVQAMAYFKELIQKRKRHPQQDMISMLLKGREKDKLTEEEAASTCILLAIAGHETT
VNLISNSVLCLLQHPEQLLKLRENPDLIGTAVEECLRYESPTQMTARVASEDIDICGVTI
RQGEQVYLLLGAANRDPSIFTNPDVFDITRSPNPHLSFGHGHHVCLGSSLARLEAQIAIN
TLLQRMPSLNLADFEWRYRPLFGFRALEELPVTFE
NT seq 1188 nt   +upstreamnt  +downstreamnt
gtgacaattgcatcgtcaactgcatcttctgagtttttgaaaaacccatattctttttac
gacacattgcgagctgttcatcctatctataaagggagtttcttaaaatacccgggctgg
tatgtcacaggatatgaagaaacggctgctattttgaaagatgcgagattcaaagtccgc
accccgctgcctgagagctcaaccaaatatcaggacctttcacatgtgcaaaatcaaatg
atgctgtttcagaaccagcctgatcatagacgattgcggacgcttgccagcggagcgttt
acgccgagaacgacagagagttatcagccgtatatcattgaaactgtccatcatttgctt
gatcaagtgcaaggtaaaaaaaagatggaggtcatttcggactttgcttttcctttagca
agttttgtcatagctaacattataggtgtaccggaggaagatagggagcaattaaaggag
tgggctgcgagtctcattcaaacgattgattttacccgctcaagaaaggcattaacagag
ggcaatattatggctgtgcaggctatggcatatttcaaagagctgattcaaaagagaaaa
cgccaccctcaacaggatatgatcagcatgctcttgaaggggagagaaaaggataagctg
acggaagaggaggcggcatctacgtgcatattgctggcgatcgccggacatgagacaacg
gtcaatctcatcagcaattcagtcctttgtctgctgcagcatccagaacagcttttgaaa
ctgagagaaaatccagatcttattggtaccgcagtcgaggaatgtttacgctatgaaagc
cccacgcaaatgacagccagagttgcgtcagaggatattgacatctgcggggtgacgatc
cgtcaaggagaacaagtctatcttttgttaggagcggctaatcgagaccctagcatattc
acgaaccccgatgtcttcgatattacgagaagtcctaatccgcatctttcattcgggcat
ggccatcatgtttgcttagggtcctcgctggcacgattagaagcgcaaattgcgattaac
actcttctgcagcgaatgcccagccttaatcttgcggattttgaatggcggtatcggccg
ctttttggatttcgggcgcttgaggagctgccggtgacttttgaataa

DBGET integrated database retrieval system