Bacillus sp. OxB-1: OXB_2129 Help Entry OXB_2129          CDS       T03635                                  Name (GenBank) RNA-binding protein hfq   KO K03666   host factor-I protein Organism baco  Bacillus sp. OxB-1 Pathway baco02024   Quorum sensing baco03018   RNA degradation Brite KEGG Orthology (KO) [BR:baco00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     OXB_2129  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     OXB_2129  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:baco03019]     OXB_2129    03036 Chromosome and associated proteins [BR:baco03036]     OXB_2129 Messenger RNA biogenesis [BR:baco03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      OXB_2129 Chromosome and associated proteins [BR:baco03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     OXB_2129 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  BAQ10600 LinkDB All DBs Position 2215220..2215444 Genome browser AA seq 74 aa AA seqDB search MAQGNMQDVFLNSLRKNNTFVTVFLLNGFQLKGLIKSYDNYTVLLESDGKQQLIYKHAIS TYVPSKPVVLKEDE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgcaagggaatatgcaggatgtttttttaaattcgttacggaaaaacaatacattt gtaacggtattcttactgaatggatttcaattgaagggcctaatcaagtcatatgataat tacacggtcctgcttgaatcggacggaaaacagcaattgatctacaaacatgcgatttct acatacgtcccatccaaaccggtcgtattgaaagaagatgaataa

DBGET integrated database retrieval system