Bacillus sp. OxB-1: OXB_2745 Help Entry OXB_2745          CDS       T03635                                  Name (GenBank) exonuclease VII small subunit   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism baco  Bacillus sp. OxB-1 Pathway baco03430   Mismatch repair Brite KEGG Orthology (KO) [BR:baco00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     OXB_2745  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:baco03400]     OXB_2745 Enzymes [BR:baco01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      OXB_2745 DNA repair and recombination proteins [BR:baco03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      OXB_2745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S HU-CCDC81_bac_2 Trimer_CC Motif Other DBs NCBI-ProteinID:  BAQ11216 UniProt:  A0A0A8JL87 LinkDB All DBs Position complement(2808030..2808272) Genome browser AA seq 80 aa AA seqDB search MEKEAIRFEEAMYKLEEVVQKLENGDVPLEDAILLYKKGMELSAYCHNKLQDAEKQLISI IDKEGNQTEFEPSKGGETNA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaaaaagaagcaatccgctttgaagaggccatgtacaaactggaagaagttgtccag aaattagaaaacggcgatgtgccgttggaagacgcgattcttttatataaaaaagggatg gaactgtcagcttattgtcacaataaattacaggacgctgaaaaacagctcatctccata attgataaagagggcaatcaaacggaattcgaaccttcgaaaggtggagaaacgaatgca tga

DBGET integrated database retrieval system