Bacillus sp. Y1: DOE78_08020 Help Entry DOE78_08020       CDS       T05922                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bacq  Bacillus sp. Y1 Pathway bacq01100   Metabolic pathways bacq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bacq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DOE78_08020    00074 Mycolic acid biosynthesis     DOE78_08020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DOE78_08020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Guanylate_cyc DUF1493 Motif Other DBs NCBI-ProteinID:  AYA75386 LinkDB All DBs Position 1619082..1619315 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVEENQVTLEASFKDDLGADSLDVVELVMELEDEFDMEISDDDA EKISTVGDAVNYIKSTQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagatgtattagagcgcgtaacgaagattatcgttgacagacttggagtagaagaa aatcaagtgactcttgaagcttctttcaaggatgatcttggtgctgattcccttgacgta gtagaactagttatggaattagaggacgagtttgatatggaaatctctgacgatgatgct gaaaagatttctacagtgggtgacgctgtgaattacataaaaagtactcaataa

DBGET integrated database retrieval system