KEGG   Bacillus sp. Y1: DOE78_13810
Entry
DOE78_13810       CDS       T05922                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
bacq  Bacillus sp. Y1
Pathway
bacq00780  Biotin metabolism
bacq01100  Metabolic pathways
bacq01240  Biosynthesis of cofactors
Module
bacq_M00573  Biotin biosynthesis, BioI pathway, long-chain-acyl-ACP => pimeloyl-ACP => biotin
Brite
KEGG Orthology (KO) [BR:bacq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    DOE78_13810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bacq00199]
    DOE78_13810
Enzymes [BR:bacq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     DOE78_13810
Cytochrome P450 [BR:bacq00199]
 Cytochrome P450, bacteria type
  CYP107 family
   DOE78_13810
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: AYA76431
UniProt: A0A385NPZ8
LinkDB
Position
complement(2827948..2829168)
AA seq 406 aa
MKNVLNEQEMITRSFSLTSPEFLRNPYPYYDKLRSINPIYWGNSVKYPGWYVTGYEEAVA
ILKDTRFQNRITLPQTSKKYEHLKNIQNDMMLFKNEPDHKRLRMLVSNVFTPSVIEAYRP
YIEETVNELLNEVENKKGMDVVSDYAFPLASLIIAKILGVPAEERNQFKEWTVTLIQTID
FTRTRMGLANGNDTIRRLLDYFRELITKRKHNPQDDLISMLIKEGEQGDKLTEEELLSTC
ILLVIAGHETTVNLISNSVLSLLNHPEQLVELKQRPTLIERAVEEFLRYESPTQMTARLA
SEDIECNGTTIKKGEQVYILLGAANRDPKKFFHANVLDITRNPNPHIAFGYGIHFCLGSS
LARLEAQIAIQTLLQRLSNLQIATPDLQWRKLTGFRSLEKLPITFT
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgaagaatgttttaaatgaacaagaaatgataaccagatcattttcacttacttctcct
gagtttttaagaaatccttatccttattatgataagctgcggtccattaatcctatctac
tgggggaactcggtaaaatatccaggatggtatgtaaccggatatgaagaggcagtagcg
atccttaaagatacccgatttcaaaatcgcattactttaccacagacatcaaaaaagtat
gagcatctaaaaaatatacagaatgacatgatgctttttaagaatgagcctgaccataag
cggttacggatgctcgtaagtaatgtatttactcccagtgttattgaagcttatcgtcct
tatatagaagaaactgttaatgaactactgaatgaggtggagaataagaaaggaatggat
gttgtttcagattatgcgtttcctttagccagcctcattatagctaaaattttaggagtt
ccagcggaggaaaggaatcaatttaaagaatggactgtaaccttaattcaaacaatagat
tttactcgaacgagaatgggattagcaaatggtaacgatacgattagaaggttactagat
tattttagagagctgattacaaagcggaaacataaccctcaagatgacctgataagcatg
ttaattaaagagggagagcagggtgacaagttaacagaagaagaattactgtcaacttgt
attttacttgttattgctggacatgaaacaacagtaaatctcataagcaattcggtcctt
tccttattaaatcaccctgagcaattagtggagctaaagcaaagaccaaccctaatcgaa
agggcagttgaggagtttttacgatatgagagcccaacccagatgacagctcgccttgca
tcagaagatattgaatgtaatgggacgaccataaaaaaaggtgaacaagtatatatcctt
ttgggagctgccaatcgagatccgaaaaaattctttcatgctaatgtgcttgatataact
aggaatcctaatcctcatattgcctttggatatggtattcatttctgtttaggttcctca
ttagcacgattagaagcacaaattgctattcaaacactcttacagcgattgtccaacctt
caaattgctactcctgacctacaatggcgaaaacttacaggttttcgatcgctagaaaaa
ctgccaattacttttacctaa

DBGET integrated database retrieval system