KEGG   Bacillus sp. SDLI1: AUL54_03100
Entry
AUL54_03100       CDS       T05207                                 
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
bacs  Bacillus sp. SDLI1
Pathway
bacs00770  Pantothenate and CoA biosynthesis
bacs01100  Metabolic pathways
bacs01240  Biosynthesis of cofactors
Module
bacs_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bacs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AUL54_03100
Enzymes [BR:bacs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     AUL54_03100
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig RGS
Other DBs
NCBI-ProteinID: AME05401
LinkDB
Position
complement(706540..707022)
AA seq 160 aa
MASIAVCPGSFDPVTYGHMDIIRRGANVFEHVYVCVLNNSSKQPLFTVEERCELLREVTK
DIPNITVETSGGLLIDYAKKKQANAIIRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMT
NNQYSFLSSSIVKEVAKYNGPVSEFVPPEVEQALQQKFKG
NT seq 483 nt   +upstreamnt  +downstreamnt
gtggcaagtatagctgtatgtcccggaagttttgatcccgtcacctacggacacatggac
attatcaggcggggagcaaacgtgtttgagcatgtgtacgtatgcgtgcttaataattct
tccaagcagccgctgtttacagtcgaagaacgctgtgagctattgcgggaagtgacaaaa
gacataccgaatattacggtcgagacgtcagggggactgttgatcgactacgcgaaaaaa
aagcaggcgaatgcgattatcaggggactcagagctgtttctgacttcgaatatgagatg
cagggaacctctgtcaaccgcgtgcttgacgagtcaatagaaaccttttttatgatgacg
aacaatcagtactcttttttaagttcaagcattgtaaaagaggtcgcaaaatataacggg
cctgtttcagagtttgttcctccggaagtcgaacaggcgctgcagcagaaatttaaagga
tga

DBGET integrated database retrieval system