KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999619
Entry
102999619         CDS       T03086                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04140  Autophagy - animal
bacu04148  Efferocytosis
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04350  TGF-beta signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04517  IgSF CAM signaling
bacu04520  Adherens junction
bacu04540  Gap junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu05010  Alzheimer disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05207  Chemical carcinogenesis - receptor activation
bacu05208  Chemical carcinogenesis - reactive oxygen species
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999619 (MAPK1)
   04012 ErbB signaling pathway
    102999619 (MAPK1)
   04014 Ras signaling pathway
    102999619 (MAPK1)
   04015 Rap1 signaling pathway
    102999619 (MAPK1)
   04350 TGF-beta signaling pathway
    102999619 (MAPK1)
   04370 VEGF signaling pathway
    102999619 (MAPK1)
   04371 Apelin signaling pathway
    102999619 (MAPK1)
   04668 TNF signaling pathway
    102999619 (MAPK1)
   04066 HIF-1 signaling pathway
    102999619 (MAPK1)
   04068 FoxO signaling pathway
    102999619 (MAPK1)
   04072 Phospholipase D signaling pathway
    102999619 (MAPK1)
   04071 Sphingolipid signaling pathway
    102999619 (MAPK1)
   04024 cAMP signaling pathway
    102999619 (MAPK1)
   04022 cGMP-PKG signaling pathway
    102999619 (MAPK1)
   04151 PI3K-Akt signaling pathway
    102999619 (MAPK1)
   04150 mTOR signaling pathway
    102999619 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102999619 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102999619 (MAPK1)
   04148 Efferocytosis
    102999619 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102999619 (MAPK1)
   04210 Apoptosis
    102999619 (MAPK1)
   04218 Cellular senescence
    102999619 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102999619 (MAPK1)
   04520 Adherens junction
    102999619 (MAPK1)
   04540 Gap junction
    102999619 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102999619 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102999619 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102999619 (MAPK1)
   04613 Neutrophil extracellular trap formation
    102999619 (MAPK1)
   04620 Toll-like receptor signaling pathway
    102999619 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102999619 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102999619 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    102999619 (MAPK1)
   04660 T cell receptor signaling pathway
    102999619 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    102999619 (MAPK1)
   04659 Th17 cell differentiation
    102999619 (MAPK1)
   04657 IL-17 signaling pathway
    102999619 (MAPK1)
   04662 B cell receptor signaling pathway
    102999619 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    102999619 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    102999619 (MAPK1)
   04062 Chemokine signaling pathway
    102999619 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102999619 (MAPK1)
   04929 GnRH secretion
    102999619 (MAPK1)
   04912 GnRH signaling pathway
    102999619 (MAPK1)
   04915 Estrogen signaling pathway
    102999619 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102999619 (MAPK1)
   04917 Prolactin signaling pathway
    102999619 (MAPK1)
   04921 Oxytocin signaling pathway
    102999619 (MAPK1)
   04926 Relaxin signaling pathway
    102999619 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    102999619 (MAPK1)
   04919 Thyroid hormone signaling pathway
    102999619 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    102999619 (MAPK1)
   04916 Melanogenesis
    102999619 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102999619 (MAPK1)
   04270 Vascular smooth muscle contraction
    102999619 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102999619 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    102999619 (MAPK1)
   04725 Cholinergic synapse
    102999619 (MAPK1)
   04726 Serotonergic synapse
    102999619 (MAPK1)
   04720 Long-term potentiation
    102999619 (MAPK1)
   04730 Long-term depression
    102999619 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    102999619 (MAPK1)
   04722 Neurotrophin signaling pathway
    102999619 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    102999619 (MAPK1)
   04380 Osteoclast differentiation
    102999619 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102999619 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102999619 (MAPK1)
   05206 MicroRNAs in cancer
    102999619 (MAPK1)
   05205 Proteoglycans in cancer
    102999619 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    102999619 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    102999619 (MAPK1)
   05203 Viral carcinogenesis
    102999619 (MAPK1)
   05230 Central carbon metabolism in cancer
    102999619 (MAPK1)
   05231 Choline metabolism in cancer
    102999619 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102999619 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102999619 (MAPK1)
   05212 Pancreatic cancer
    102999619 (MAPK1)
   05225 Hepatocellular carcinoma
    102999619 (MAPK1)
   05226 Gastric cancer
    102999619 (MAPK1)
   05214 Glioma
    102999619 (MAPK1)
   05216 Thyroid cancer
    102999619 (MAPK1)
   05221 Acute myeloid leukemia
    102999619 (MAPK1)
   05220 Chronic myeloid leukemia
    102999619 (MAPK1)
   05218 Melanoma
    102999619 (MAPK1)
   05211 Renal cell carcinoma
    102999619 (MAPK1)
   05219 Bladder cancer
    102999619 (MAPK1)
   05215 Prostate cancer
    102999619 (MAPK1)
   05213 Endometrial cancer
    102999619 (MAPK1)
   05224 Breast cancer
    102999619 (MAPK1)
   05223 Non-small cell lung cancer
    102999619 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102999619 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    102999619 (MAPK1)
   05161 Hepatitis B
    102999619 (MAPK1)
   05160 Hepatitis C
    102999619 (MAPK1)
   05171 Coronavirus disease - COVID-19
    102999619 (MAPK1)
   05164 Influenza A
    102999619 (MAPK1)
   05163 Human cytomegalovirus infection
    102999619 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999619 (MAPK1)
   05165 Human papillomavirus infection
    102999619 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102999619 (MAPK1)
   05135 Yersinia infection
    102999619 (MAPK1)
   05133 Pertussis
    102999619 (MAPK1)
   05152 Tuberculosis
    102999619 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102999619 (MAPK1)
   05140 Leishmaniasis
    102999619 (MAPK1)
   05142 Chagas disease
    102999619 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102999619 (MAPK1)
   05020 Prion disease
    102999619 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    102999619 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    102999619 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102999619 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102999619 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102999619 (MAPK1)
   04934 Cushing syndrome
    102999619 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102999619 (MAPK1)
   01524 Platinum drug resistance
    102999619 (MAPK1)
   01522 Endocrine resistance
    102999619 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102999619 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    102999619 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    102999619 (MAPK1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102999619 (MAPK1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102999619 (MAPK1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102999619 (MAPK1)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102999619 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Choline_kinase Kinase-like Kdo
Other DBs
NCBI-GeneID: 102999619
NCBI-ProteinID: XP_007196357
LinkDB
Position
Un
AA seq 263 aa
MKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLL
NTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNR
LFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDD
LPKEKLKELIFEETARFQPGYRS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgaaagatgtatatatagtacaggacctcatggaaacagatctctacaagctcttgaag
acgcaacacctcagcaacgaccatatctgctattttctttaccagatcctcagagggtta
aaatatatccattcagctaacgtgctgcaccgtgacctcaaaccttccaacctgctgctc
aacaccacctgcgatctcaagatctgtgactttggcttggcccgtgttgcagatccagac
catgatcacacagggttcctgacggagtatgttgccacacgttggtacagggctccggaa
attatgttgaattccaagggctacaccaagtccattgatatttggtctgtaggctgcatc
ctggcagagatgctctccaacaggcccatcttcccggggaagcattacctcgaccagctg
aaccacattctgggtattcttggatccccatcccaggaagacctgaattgtataataaat
ttaaaagctagaaactatttgctttctcttccgcacaaaaataaggtgccatggaacagg
ctgttcccaaatgctgactccaaagctctggatttactggacaagatgttgacgttcaac
cctcataagaggattgaggtggaacaggctctggcccacccgtacctggagcagtactac
gacccaagtgacgagcccatcgccgaagcaccgttcaagtttgacatggaattggatgac
ttgcccaaggaaaagctcaaagaactcatttttgaagagaccgctagattccagccagga
tacagatcttaa

DBGET integrated database retrieval system