KEGG   Balaenoptera acutorostrata scammoni (minke whale): 102999798
Entry
102999798         CDS       T03086                                 
Name
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04015  Rap1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04114  Oocyte meiosis
bacu04148  Efferocytosis
bacu04218  Cellular senescence
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04370  VEGF signaling pathway
bacu04380  Osteoclast differentiation
bacu04517  IgSF CAM signaling
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04668  TNF signaling pathway
bacu04670  Leukocyte transendothelial migration
bacu04714  Thermogenesis
bacu04722  Neurotrophin signaling pathway
bacu04723  Retrograde endocannabinoid signaling
bacu04728  Dopaminergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04917  Prolactin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04936  Alcoholic liver disease
bacu05014  Amyotrophic lateral sclerosis
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05205  Proteoglycans in cancer
bacu05208  Chemical carcinogenesis - reactive oxygen species
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05415  Diabetic cardiomyopathy
bacu05417  Lipid and atherosclerosis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102999798
   04015 Rap1 signaling pathway
    102999798
   04370 VEGF signaling pathway
    102999798
   04668 TNF signaling pathway
    102999798
   04068 FoxO signaling pathway
    102999798
   04071 Sphingolipid signaling pathway
    102999798
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    102999798
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    102999798
  09143 Cell growth and death
   04114 Oocyte meiosis
    102999798
   04218 Cellular senescence
    102999798
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102999798
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102999798
   04613 Neutrophil extracellular trap formation
    102999798
   04620 Toll-like receptor signaling pathway
    102999798
   04621 NOD-like receptor signaling pathway
    102999798
   04622 RIG-I-like receptor signaling pathway
    102999798
   04625 C-type lectin receptor signaling pathway
    102999798
   04660 T cell receptor signaling pathway
    102999798
   04658 Th1 and Th2 cell differentiation
    102999798
   04659 Th17 cell differentiation
    102999798
   04657 IL-17 signaling pathway
    102999798
   04664 Fc epsilon RI signaling pathway
    102999798
   04670 Leukocyte transendothelial migration
    102999798
  09152 Endocrine system
   04912 GnRH signaling pathway
    102999798
   04914 Progesterone-mediated oocyte maturation
    102999798
   04917 Prolactin signaling pathway
    102999798
   04926 Relaxin signaling pathway
    102999798
   04935 Growth hormone synthesis, secretion and action
    102999798
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102999798
  09156 Nervous system
   04728 Dopaminergic synapse
    102999798
   04723 Retrograde endocannabinoid signaling
    102999798
   04722 Neurotrophin signaling pathway
    102999798
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102999798
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102999798
  09159 Environmental adaptation
   04714 Thermogenesis
    102999798
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    102999798
   05208 Chemical carcinogenesis - reactive oxygen species
    102999798
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102999798
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102999798
   05161 Hepatitis B
    102999798
   05171 Coronavirus disease - COVID-19
    102999798
   05163 Human cytomegalovirus infection
    102999798
   05167 Kaposi sarcoma-associated herpesvirus infection
    102999798
   05169 Epstein-Barr virus infection
    102999798
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102999798
   05135 Yersinia infection
    102999798
   05133 Pertussis
    102999798
   05152 Tuberculosis
    102999798
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102999798
   05140 Leishmaniasis
    102999798
   05142 Chagas disease
    102999798
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102999798
   05020 Prion disease
    102999798
   05022 Pathways of neurodegeneration - multiple diseases
    102999798
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102999798
   05418 Fluid shear stress and atherosclerosis
    102999798
   05415 Diabetic cardiomyopathy
    102999798
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    102999798
   04932 Non-alcoholic fatty liver disease
    102999798
   04933 AGE-RAGE signaling pathway in diabetic complications
    102999798
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102999798
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    102999798
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102999798
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102999798
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH ABC1 RIO1 TAP42
Other DBs
NCBI-GeneID: 102999798
NCBI-ProteinID: XP_007195121
LinkDB
Position
Un
AA seq 203 aa
MDPFFKRVDRIDSSEEPDAVPSTGAPRSSAVDSRTGAKVAIKKLYRPFQSELFAKRAYRE
LRLLKHMRHENVIGLLDVFTPNETLDDFTDFYLVMPFMGTDLGKLMKHEKLSEDRIQFLV
YQMLKGLKYIHAAGIIHRDLKPGNLAVNEDCELKVCVGLGARAAPPPHLPIGPPAPWPSG
LEVDWPRPRRRDRPQPSRQWPSS
NT seq 612 nt   +upstreamnt  +downstreamnt
atggatcctttcttcaagagggtagatagaattgattccagcgaggaaccagatgctgta
ccatcaaccggtgcgccccgcagctcggccgtggacagccgcacgggcgccaaggtggcc
ataaagaagctgtaccggcccttccagtccgagctgttcgccaagcgcgcctaccgcgag
ctgcgcctgctcaagcacatgcgccatgagaacgtaattgggctgctggatgtgttcaca
cccaatgagaccctggatgatttcacagacttttacctggtgatgccgttcatgggcacc
gacctggggaagctcatgaagcacgagaagctgagtgaggaccggatccagttcctcgtc
taccagatgctcaaggggctgaagtacatccacgctgctggcatcatccacagggacctg
aagcccggcaacctggccgtgaacgaggactgtgagctgaaggtgtgtgtggggttgggg
gctcgggccgccccccccccgcacctgcccatcggcccgccggccccttggccctcaggc
ctggaggtggactggcccaggcccaggcggagggacagaccacagccatccaggcagtgg
ccgagcagctga

DBGET integrated database retrieval system