KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002590
Entry
103002590         CDS       T03086                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04140  Autophagy - animal
bacu04148  Efferocytosis
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04350  TGF-beta signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04540  Gap junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04930  Type II diabetes mellitus
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu05010  Alzheimer disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05207  Chemical carcinogenesis - receptor activation
bacu05208  Chemical carcinogenesis - reactive oxygen species
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002590 (MAPK3)
   04012 ErbB signaling pathway
    103002590 (MAPK3)
   04014 Ras signaling pathway
    103002590 (MAPK3)
   04015 Rap1 signaling pathway
    103002590 (MAPK3)
   04350 TGF-beta signaling pathway
    103002590 (MAPK3)
   04370 VEGF signaling pathway
    103002590 (MAPK3)
   04371 Apelin signaling pathway
    103002590 (MAPK3)
   04668 TNF signaling pathway
    103002590 (MAPK3)
   04066 HIF-1 signaling pathway
    103002590 (MAPK3)
   04068 FoxO signaling pathway
    103002590 (MAPK3)
   04072 Phospholipase D signaling pathway
    103002590 (MAPK3)
   04071 Sphingolipid signaling pathway
    103002590 (MAPK3)
   04024 cAMP signaling pathway
    103002590 (MAPK3)
   04022 cGMP-PKG signaling pathway
    103002590 (MAPK3)
   04151 PI3K-Akt signaling pathway
    103002590 (MAPK3)
   04150 mTOR signaling pathway
    103002590 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103002590 (MAPK3)
   04148 Efferocytosis
    103002590 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103002590 (MAPK3)
   04210 Apoptosis
    103002590 (MAPK3)
   04218 Cellular senescence
    103002590 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103002590 (MAPK3)
   04520 Adherens junction
    103002590 (MAPK3)
   04540 Gap junction
    103002590 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103002590 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103002590 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103002590 (MAPK3)
   04613 Neutrophil extracellular trap formation
    103002590 (MAPK3)
   04620 Toll-like receptor signaling pathway
    103002590 (MAPK3)
   04621 NOD-like receptor signaling pathway
    103002590 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    103002590 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    103002590 (MAPK3)
   04660 T cell receptor signaling pathway
    103002590 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    103002590 (MAPK3)
   04659 Th17 cell differentiation
    103002590 (MAPK3)
   04657 IL-17 signaling pathway
    103002590 (MAPK3)
   04662 B cell receptor signaling pathway
    103002590 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    103002590 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    103002590 (MAPK3)
   04062 Chemokine signaling pathway
    103002590 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103002590 (MAPK3)
   04929 GnRH secretion
    103002590 (MAPK3)
   04912 GnRH signaling pathway
    103002590 (MAPK3)
   04915 Estrogen signaling pathway
    103002590 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    103002590 (MAPK3)
   04917 Prolactin signaling pathway
    103002590 (MAPK3)
   04921 Oxytocin signaling pathway
    103002590 (MAPK3)
   04926 Relaxin signaling pathway
    103002590 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    103002590 (MAPK3)
   04919 Thyroid hormone signaling pathway
    103002590 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    103002590 (MAPK3)
   04916 Melanogenesis
    103002590 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103002590 (MAPK3)
   04270 Vascular smooth muscle contraction
    103002590 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103002590 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103002590 (MAPK3)
   04725 Cholinergic synapse
    103002590 (MAPK3)
   04726 Serotonergic synapse
    103002590 (MAPK3)
   04720 Long-term potentiation
    103002590 (MAPK3)
   04730 Long-term depression
    103002590 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    103002590 (MAPK3)
   04722 Neurotrophin signaling pathway
    103002590 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    103002590 (MAPK3)
   04380 Osteoclast differentiation
    103002590 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103002590 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002590 (MAPK3)
   05206 MicroRNAs in cancer
    103002590 (MAPK3)
   05205 Proteoglycans in cancer
    103002590 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    103002590 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    103002590 (MAPK3)
   05203 Viral carcinogenesis
    103002590 (MAPK3)
   05230 Central carbon metabolism in cancer
    103002590 (MAPK3)
   05231 Choline metabolism in cancer
    103002590 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103002590 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103002590 (MAPK3)
   05212 Pancreatic cancer
    103002590 (MAPK3)
   05225 Hepatocellular carcinoma
    103002590 (MAPK3)
   05226 Gastric cancer
    103002590 (MAPK3)
   05214 Glioma
    103002590 (MAPK3)
   05216 Thyroid cancer
    103002590 (MAPK3)
   05221 Acute myeloid leukemia
    103002590 (MAPK3)
   05220 Chronic myeloid leukemia
    103002590 (MAPK3)
   05218 Melanoma
    103002590 (MAPK3)
   05211 Renal cell carcinoma
    103002590 (MAPK3)
   05219 Bladder cancer
    103002590 (MAPK3)
   05215 Prostate cancer
    103002590 (MAPK3)
   05213 Endometrial cancer
    103002590 (MAPK3)
   05224 Breast cancer
    103002590 (MAPK3)
   05223 Non-small cell lung cancer
    103002590 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103002590 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    103002590 (MAPK3)
   05161 Hepatitis B
    103002590 (MAPK3)
   05160 Hepatitis C
    103002590 (MAPK3)
   05171 Coronavirus disease - COVID-19
    103002590 (MAPK3)
   05164 Influenza A
    103002590 (MAPK3)
   05163 Human cytomegalovirus infection
    103002590 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103002590 (MAPK3)
   05165 Human papillomavirus infection
    103002590 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103002590 (MAPK3)
   05135 Yersinia infection
    103002590 (MAPK3)
   05133 Pertussis
    103002590 (MAPK3)
   05152 Tuberculosis
    103002590 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103002590 (MAPK3)
   05140 Leishmaniasis
    103002590 (MAPK3)
   05142 Chagas disease
    103002590 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103002590 (MAPK3)
   05020 Prion disease
    103002590 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    103002590 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    103002590 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103002590 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103002590 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103002590 (MAPK3)
   04934 Cushing syndrome
    103002590 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103002590 (MAPK3)
   01524 Platinum drug resistance
    103002590 (MAPK3)
   01522 Endocrine resistance
    103002590 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103002590 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103002590 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103002590 (MAPK3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103002590 (MAPK3)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103002590 (MAPK3)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103002590 (MAPK3)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103002590 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 NDUF_B4
Other DBs
NCBI-GeneID: 103002590
NCBI-ProteinID: XP_007186424
UniProt: A0A384AGR0
LinkDB
Position
Un
AA seq 265 aa
MRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLI
NTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI
LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAK
LFPKSDPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDD
LPKERLKELIFQETARFQPGVLEAP
NT seq 798 nt   +upstreamnt  +downstreamnt
atgagggatgtgtacattgtgcaagacctgatggagacagacctgtacaagttgcttaaa
agccagcagctgagcaacgaccacatctgctacttcctctaccaaatcctgaggggcctc
aagtatatccactccgccaacgtgctccaccgggatttaaagccctccaacctgctcatc
aacaccacctgcgaccttaagatctgtgattttggtcttgcccggatcgccgatcctgag
cacgaccacactggctttctgacggaatacgtggccacacgctggtaccgggccccagag
atcatgcttaactccaagggctacaccaagtccatcgacatctggtctgtgggctgcatt
ctggctgagatgctctccaaccggcccatcttcccgggcaagcactacctggaccagctc
aaccacattctgggtatcctgggctccccctcccaggaggacctgaattgtatcatcaac
atgaaggcccgaaactacctacagtctctaccctccaagaccaaggtggcctgggccaag
ctttttcccaagtcggaccccaaagctcttgacctactggaccggatgttgacctttaac
cccaacaaacggatcacagtggaagaagcactggctcacccctacctggagcagtactac
gacccaacagatgagccagtggccgaggaacctttcaccttcgacatggagctggatgat
ctacccaaggagcggctgaaggagctcatcttccaggagacagcccgcttccagcctggg
gtgctggaggccccctaa

DBGET integrated database retrieval system