KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004931
Entry
103004931         CDS       T03086                                 
Symbol
NRAS
Name
(RefSeq) neuroblastoma RAS viral oncogene homolog
  KO
K07828  GTPase NRas
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04062  Chemokine signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04137  Mitophagy - animal
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04625  C-type lectin receptor signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04714  Thermogenesis
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05207  Chemical carcinogenesis - receptor activation
bacu05208  Chemical carcinogenesis - reactive oxygen species
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103004931 (NRAS)
   04012 ErbB signaling pathway
    103004931 (NRAS)
   04014 Ras signaling pathway
    103004931 (NRAS)
   04015 Rap1 signaling pathway
    103004931 (NRAS)
   04370 VEGF signaling pathway
    103004931 (NRAS)
   04371 Apelin signaling pathway
    103004931 (NRAS)
   04068 FoxO signaling pathway
    103004931 (NRAS)
   04072 Phospholipase D signaling pathway
    103004931 (NRAS)
   04071 Sphingolipid signaling pathway
    103004931 (NRAS)
   04151 PI3K-Akt signaling pathway
    103004931 (NRAS)
   04150 mTOR signaling pathway
    103004931 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103004931 (NRAS)
   04137 Mitophagy - animal
    103004931 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    103004931 (NRAS)
   04218 Cellular senescence
    103004931 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103004931 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    103004931 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103004931 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103004931 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    103004931 (NRAS)
   04660 T cell receptor signaling pathway
    103004931 (NRAS)
   04662 B cell receptor signaling pathway
    103004931 (NRAS)
   04664 Fc epsilon RI signaling pathway
    103004931 (NRAS)
   04062 Chemokine signaling pathway
    103004931 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103004931 (NRAS)
   04929 GnRH secretion
    103004931 (NRAS)
   04912 GnRH signaling pathway
    103004931 (NRAS)
   04915 Estrogen signaling pathway
    103004931 (NRAS)
   04917 Prolactin signaling pathway
    103004931 (NRAS)
   04921 Oxytocin signaling pathway
    103004931 (NRAS)
   04926 Relaxin signaling pathway
    103004931 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    103004931 (NRAS)
   04919 Thyroid hormone signaling pathway
    103004931 (NRAS)
   04916 Melanogenesis
    103004931 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    103004931 (NRAS)
   04726 Serotonergic synapse
    103004931 (NRAS)
   04720 Long-term potentiation
    103004931 (NRAS)
   04730 Long-term depression
    103004931 (NRAS)
   04722 Neurotrophin signaling pathway
    103004931 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    103004931 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    103004931 (NRAS)
   04213 Longevity regulating pathway - multiple species
    103004931 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    103004931 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004931 (NRAS)
   05206 MicroRNAs in cancer
    103004931 (NRAS)
   05205 Proteoglycans in cancer
    103004931 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    103004931 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    103004931 (NRAS)
   05203 Viral carcinogenesis
    103004931 (NRAS)
   05230 Central carbon metabolism in cancer
    103004931 (NRAS)
   05231 Choline metabolism in cancer
    103004931 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103004931 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103004931 (NRAS)
   05225 Hepatocellular carcinoma
    103004931 (NRAS)
   05226 Gastric cancer
    103004931 (NRAS)
   05214 Glioma
    103004931 (NRAS)
   05216 Thyroid cancer
    103004931 (NRAS)
   05221 Acute myeloid leukemia
    103004931 (NRAS)
   05220 Chronic myeloid leukemia
    103004931 (NRAS)
   05218 Melanoma
    103004931 (NRAS)
   05211 Renal cell carcinoma
    103004931 (NRAS)
   05219 Bladder cancer
    103004931 (NRAS)
   05215 Prostate cancer
    103004931 (NRAS)
   05213 Endometrial cancer
    103004931 (NRAS)
   05224 Breast cancer
    103004931 (NRAS)
   05223 Non-small cell lung cancer
    103004931 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103004931 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    103004931 (NRAS)
   05161 Hepatitis B
    103004931 (NRAS)
   05160 Hepatitis C
    103004931 (NRAS)
   05163 Human cytomegalovirus infection
    103004931 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103004931 (NRAS)
   05165 Human papillomavirus infection
    103004931 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103004931 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103004931 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    103004931 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103004931 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103004931 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103004931 (NRAS)
   01522 Endocrine resistance
    103004931 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103004931 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103004931 (NRAS)
   04031 GTP-binding proteins [BR:bacu04031]
    103004931 (NRAS)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    103004931 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    103004931 (NRAS)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103004931 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   103004931 (NRAS)
  Exosomal proteins of breast cancer cells
   103004931 (NRAS)
  Exosomal proteins of colorectal cancer cells
   103004931 (NRAS)
GTP-binding proteins [BR:bacu04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    103004931 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 103004931
NCBI-ProteinID: XP_007169415
UniProt: A0A383Z2W3
LinkDB
Position
Un
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattgccatgtgtggtgatgtaa

DBGET integrated database retrieval system