Balaenoptera acutorostrata scammoni (minke whale): 103005308
Help
Entry
103005308 CDS
T03086
Symbol
NDUFA11
Name
(RefSeq) NADH:ubiquinone oxidoreductase subunit A11
KO
K03956
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11
Organism
bacu
Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00190
Oxidative phosphorylation
bacu01100
Metabolic pathways
bacu04714
Thermogenesis
bacu04723
Retrograde endocannabinoid signaling
bacu04932
Non-alcoholic fatty liver disease
bacu05010
Alzheimer disease
bacu05012
Parkinson disease
bacu05014
Amyotrophic lateral sclerosis
bacu05016
Huntington disease
bacu05020
Prion disease
bacu05022
Pathways of neurodegeneration - multiple diseases
bacu05208
Chemical carcinogenesis - reactive oxygen species
bacu05415
Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:
bacu00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
103005308 (NDUFA11)
09150 Organismal Systems
09156 Nervous system
04723 Retrograde endocannabinoid signaling
103005308 (NDUFA11)
09159 Environmental adaptation
04714 Thermogenesis
103005308 (NDUFA11)
09160 Human Diseases
09161 Cancer: overview
05208 Chemical carcinogenesis - reactive oxygen species
103005308 (NDUFA11)
09164 Neurodegenerative disease
05010 Alzheimer disease
103005308 (NDUFA11)
05012 Parkinson disease
103005308 (NDUFA11)
05014 Amyotrophic lateral sclerosis
103005308 (NDUFA11)
05016 Huntington disease
103005308 (NDUFA11)
05020 Prion disease
103005308 (NDUFA11)
05022 Pathways of neurodegeneration - multiple diseases
103005308 (NDUFA11)
09166 Cardiovascular disease
05415 Diabetic cardiomyopathy
103005308 (NDUFA11)
09167 Endocrine and metabolic disease
04932 Non-alcoholic fatty liver disease
103005308 (NDUFA11)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Tim17
Motif
Other DBs
NCBI-GeneID:
103005308
NCBI-ProteinID:
XP_007169187
UniProt:
A0A383Z266
LinkDB
All DBs
Position
Un
AA seq
141 aa
AA seq
DB search
MAKRLLHQYWDIPEGTECHRKTYATTSIGGATGLVVSAYSVALQTPASFLDGVARTGRYT
FTAAAIGAVFGLTSCISAQVREKPDDPLNYFLGGCAGGLTLGARTHSYGIGAAACAYMGI
TAALVKMGQLEGWKVFAEPKV
NT seq
426 nt
NT seq
+upstream
nt +downstream
nt
atggctaagaggcttcttcaccagtactgggacatccccgaaggtaccgagtgccaccgc
aagacctacgccaccaccagtatcggtggtgccactggcctcgttgtctccgcctacagc
gtggcgctccagaccccggcctccttcctggacggagtggcgaggacagggcggtacacg
tttaccgcagccgccatcggtgccgtattcggccttacctcctgcatcagtgcccaggtc
cgcgagaagcctgacgaccctctcaactacttcctcggaggctgtgccggaggcttgacc
ctgggagcgcgcacccacagctacgggattggagctgccgcctgtgcgtacatgggcatt
acggccgccctggtcaagatgggccagctggagggctggaaggtgtttgcagagcccaag
gtgtga
DBGET
integrated database retrieval system