KEGG   Bacillus sp. YP1: QF06_04590
Entry
QF06_04590        CDS       T03701                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
bacy  Bacillus sp. YP1
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacy03000]
    QF06_04590
Transcription factors [BR:bacy03000]
 Prokaryotic type
  Other transcription factors
   Others
    QF06_04590
SSDB
Motif
Pfam: Bmp Peripla_BP_4 LPAM_2
Other DBs
NCBI-ProteinID: AJO57756
LinkDB
Position
944144..945097
AA seq 317 aa
MITRLVMIFSVLLLLSGCGQTPFKGKIEKVGMLFPDTINDLVWGTKGYKGLLNIQSKYNV
DVYYKEGVKTEEDIINAIEDFHKRGVNLLYGHGSEYAEVFNLVGEDYPDMEFVISNAKAK
ADNVTSVHFSGEAMGFFGGMTAAHMSKTNQVGVIASFTWQPEVDGFIKGAKYENPDIEVN
TKYTDHWDDDTTAVKLYQKMKNEGADVVYPAGDGYNVPVIQQIKKDGLYAIGYVTDQSDL
GENTVLTSTVQNVDKAYEIIAEQFNKGTLEGGDHYYDLNTGVVEMGTFSPLVDQDFQQRI
AKLIKTYNKTGELPKNE
NT seq 954 nt   +upstreamnt  +downstreamnt
ttgatcacaaggcttgtcatgatcttttctgtcctccttttattgagtggatgtggacaa
actccgttcaaaggaaaaattgagaaggtcggcatgctctttcctgatacgattaatgac
ctcgtatggggcacaaaagggtataaaggattactgaatatacaatccaaatacaatgtg
gacgtctattataaagaaggcgttaaaacagaagaagatatcataaatgcgattgaggat
tttcataagaggggcgtcaatctgctctacggccatgggagtgaatatgctgaggtgttt
aacttggtcggcgaagattatccagatatggaattcgtcatttccaatgcgaaagcgaaa
gctgataatgtaacaagtgtccattttagcggggaagcaatgggcttttttggaggaatg
actgctgcccatatgtcgaaaacgaatcaggtcggtgtaattgcttcctttacgtggcag
cctgaggtggacggttttatcaaaggggccaagtatgaaaatccggatatagaggtaaat
acgaaatatacggatcattgggatgatgatacaacagcagtaaagctttatcagaaaatg
aagaacgaaggcgcggatgttgtgtatcccgccggagacgggtataatgttcctgttatt
cagcaaatcaaaaaagacggtctttatgccataggctacgtcacagatcaatcggatctg
ggcgagaataccgtattaaccagcacggtgcaaaatgtggacaaggcctatgaaatcatt
gctgaacaatttaataaaggcacccttgagggcggcgatcattactacgacctgaacacg
ggagtcgttgagatgggaacattcagcccgctcgtcgatcaagactttcagcaaagaatc
gccaagctgatcaaaacatacaacaaaacaggcgagctgccaaaaaacgagtaa

DBGET integrated database retrieval system