Bacillus sp. YP1: QF06_09590 Help Entry QF06_09590        CDS       T03701                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism bacy  Bacillus sp. YP1 Brite KEGG Orthology (KO) [BR:bacy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bacy03032]     QF06_09590    03036 Chromosome and associated proteins [BR:bacy03036]     QF06_09590    03400 DNA repair and recombination proteins [BR:bacy03400]     QF06_09590 DNA replication proteins [BR:bacy03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     QF06_09590 Chromosome and associated proteins [BR:bacy03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     QF06_09590 DNA repair and recombination proteins [BR:bacy03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       QF06_09590 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Rpf1_C DUF2267 HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  AJO58705 LinkDB All DBs Position complement(1993511..1993789) Genome browser AA seq 92 aa AA seqDB search MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKG RNPQTGEEIEIPASKVPAFKPGKALKDAVAGK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaacttatcaatgcggttgctgaagcaagcgaattgtctaaaaaagac gctacaaaagcagttgactctgtttttgatacgatcttagatgcacttaaaaacggtgat aaaatccaactgatcggttttggtaacttcgaggtgcgtgaacgttctgcacgtaaagga cgcaaccctcaaacaggtgaagaaatcgaaattccagcaagcaaagtacctgctttcaaa ccaggtaaagcgcttaaagacgcagttgccggaaaataa

DBGET integrated database retrieval system